No preview available
HomeMy WebLinkAbout2024-09-10 - Agendas - Final 1 Water, Sewer, and Solid Waste Committee 10 September 2024 5:30 P.M. (Or immediately following City Council Agenda Session) Committee: Council Member Teresa Turk, Council Member D’Andre Jones, Council Member Mike Wiederkehr, Council Member Scott Berna Copy to: Mayor Lioneld Jordan, Paul Becker, Susan Norton, Kara Paxton, Kit Williams, Chris Brown, Alan Pugh, Terry Gulley, Ross Jackson, Peter Nierengarten, Brian Pugh, Corey Granderson, Aaron Watkins, Cody Ashworth, Greg Weeks, Ryan Harrold, Andy Appleton, Steve Meininger, Chris Buntin, Kamyar Sardari From: Tim Nyander, Utilities Director ______________________________________________________________________ CALL TO ORDER UPDATES PRESENTATIONS 1. Overview of July’s WRRF Monthly Report Ryan Harrold – Project Manager, Jacobs Engineering 2. Inframark Discussion – Steve Meininger, CEO of Inframark 3. Noland Water Resource Recovery Facility Master Plan City Staff and engineers from Garver will discuss the findings and recommendations of the recently completed facility master plan for the Noland WRRF. OLD BUSINESS: 2 NEW BUSINESS 4. Rate Study Discussion Discussion on the timeline of the next water & sewer rate study.; 5. Waterline Condition Assessment Project – RJN In August of 2022, after two large breaks on the City’s 36-inch water transmission main, a contract amendment with McClelland Engineers was approved to expedite the construction of a new 48-inch diameter west transmission water main. There were three reasons articulated by City staff to justify expediting this large transmission main: poor condition of portions of the 36- inch existing main, growing demands outpacing master plan projections, and the inability to assess or repair portions of the 36-inch line due to these demands. Since this time, the 48-inch waterline project has progressed rapidly towards construction, with the first onsite work anticipated September 2024 and project completion mid-2026. Now that the 48-inch west transmission water line is funded and being implemented, it is time for the City to perform critical condition assessment of the 36-inch waterline. Furthermore, condition assessment of all the waterlines 24-inch and larger should be considered at this time, as this task has never been performed in Fayetteville to-date. The risk of any infrastructure failing is comprised of two factors: Likelihood of Failure, and the Consequence of Failure. Our larger waterlines consist of approximately 47-miles of waterline 24-inch diameter and larger. The “consequence” of failure on these lines would be tremendous water loss, damage to property, loss of service, boil orders, etc. Emergency repair of these larger lines is very difficult, slow, and costly. The “likelihood” of failure is unknown on these assets and this engineering contract aims to gather data to inform this metric. The industry best-practice is to perform condition assessments on critical infrastructure so that proactive repairs or replacements can be budgeted and accomplished ahead of catastrophic breaks. Instead of immediately engaging a pipeline scanning technology provider, a preliminary study phase is prudent. The proposed contract with RJN Group would assist the City with determining feasibility, best appropriate technology, and cost estimates for assessing the condition of 47-miles of critical waterlines in our system. Industry-wide, these condition assessment technologies have resulted in pinpointing needed repairs/replacements versus traditional full-replacement alternatives. A more surgical approach to pipeline repair and reconditioning will allow rate payer dollars to stretch further, getting the most life possible out of our pipelines. Some of the key scope items in this contract are: • Review of all available pipeline records, leak histories, and existing conditions/constraints. • Evaluation of technology alternatives based on pipe size, material, age, location, etc. • Feasibility recommendations for pipeline access, tapping, dewatering, and all associated site-civil related costs. • Soil corrosivity investigations along pipe alignments. • Prioritizations, recommendations, and cost estimates for most critical next steps. At the completion of this preliminary study the City would be equipped to engage the appropriate technology provider to perform the most effective assessments of our most critical waterline assets with reduced unknowns. Staff recommends approval of an Engineering 3 Services Agreement with RJN Group, Inc. in the amount of $267,380.00 for Waterline Condition Assessment Pre-planning services. STAFF REQUESTS THIS BE FORWARDED TO THE CITY COUNCIL FOR CONSIDERATION FOR APPROVAL 6. Verizon Tower Lease Since October 1999, Verizon has leased space on the Gulley water tank for their cell antennas and associated equipment. There have been five amendments to the original lease, most of which were equipment modifications like this proposed Sixth Amendment. The Sixth Amendment outlines a new exhibit C-4 with a revised equipment list. Three new antennas will be installed on the railing of the water tank. An Antenna Mount Analysis is attached to confirm the railing will support the weight of the three new antennas. Existing antennas and other equipment will also be replaced as well as some cabling work. City Staff negotiated a $300/month increase to the rental amount based on the three new antennas that will be added. The current monthly rental amount that Verizon pays the City for this lease is $2,427.41, and after the $300 increase the rental amount will be $2,727.41. STAFF REQUESTS THIS BE FORWARDED TO THE CITY COUNCIL FOR CONSIDERATION FOR APPROVAL 7. McClelland Engineers Amendment for North College Construction Project In conjunction with the City’s roadway improvements along College Avenue from North St. to Sycamore St. the existing waterline is being replaced due to age, poor condition, and need for additional capacity. The waterline improvements were bid together with the roadway project and the City Council recently approved the construction award (Res. 206-24). The Water & Sewer division intends to provide daily observation and inspection with in-house staff, but support services are needed by the Engineer of Record, McClelland, for administrative tasks, and closeout support. Staff recommends approval of Amendment No. 1 to the Engineering Services Agreement with McClelland Consulting Engineers, Inc. for Construction Phase Services for the College Avenue Waterline Replacement Project from North St. to Sycamore St. in the amount of $35,300.00. STAFF REQUESTS THIS BE FORWARDED TO THE CITY COUNCIL FOR CONSIDERATION FOR APPROVAL 8. Regulation 5 and Liquid Animal Waste Management Systems Discussion by Committee Chair on this topic. PRESENTATIONS July WRRF Report Inframark Discussion Noland Facility Master Plan Presentation 4 ATTACHMENTS July WRRF Report Noland Facility Master Plan Executive Summary RJN Agreement Antenna Mounting Analysis – Gulley Water Tank Verizon Amendment No. 6 MCE Amendment No. 1 ADJOURN Next Water, Sewer, Solid Waste Committee meets on Tuesday, October 8th, 2024, at 5:30 p.m. City of Fayetteville Client Monthly Report for July 2024 Prepared by: August 20, 2024 Client Monthly Report Seed Harvesting Biodiversity in Integrated Vegetation Management Jacobs Community Involvement July 2024 Monthly Report Jacobs - Fayetteville i Table of Contents 1. Executive Summary.................................................................................................................................... 2 1.1 Fayetteville Team ...................................................................................................................................................... 2 1.2 Compliance .................................................................................................................................................................. 2 1.3 Financials ...................................................................................................................................................................... 2 Table 1.1: Year to Date Budget .......................................................................................................................................... 2 2. Plant Operations ......................................................................................................................................... 3 2.1 Noland ............................................................................................................................................................................ 3 2.2 West Side ....................................................................................................................................................................... 3 3. Laboratory .................................................................................................................................................... 4 4. Biosolids Management Site ..................................................................................................................... 5 4.1 Biosolids Operations ................................................................................................................................................. 5 4.2 Water Treatment Residuals .................................................................................................................................... 5 4.3 Hay Harvest .................................................................................................................................................................. 5 4.4 Dryer Operation .......................................................................................................................................................... 6 4.5 Revenue ......................................................................................................................................................................... 6 Table 4.1: Revenue generated from the BMS .............................................................................................................. 6 5. Maintenance ................................................................................................................................................ 7 5.1 Noland ............................................................................................................................................................................ 7 5.2 West Side ....................................................................................................................................................................... 7 5.3 Lift Stations .................................................................................................................................................................. 8 5.4 Key Performance Indicators/Measures ............................................................................................................. 9 Figure 5-1: Labor Hours by Work Order Type ............................................................................................................... 9 Figure 5-2: Work Order Count by Type............................................................................................................................ 9 5.5 Capital Improvement Projects (CIP) ................................................................................................................ 10 6. Industrial Pretreatment ......................................................................................................................... 11 Table 6.1: Industrial Pretreatment Program (IPP) Revenue Summary .......................................................... 11 7. Safety .......................................................................................................................................................... 13 8. Woolsey Wet Prairie ................................................................................................................................ 14 Appendix A: Noland Effluent & Influent Report ............................................................................................ 16 Appendix B: West Side Effluent & Influent Report ........................................................................................ 17 Appendix C: Jacobs Employee Vacancy and Project Status Report .......................................................... 18 July 2024 Monthly Report Jacobs - Fayetteville ii 1. Executive Summary 1.1 Fayetteville Team In June, the Fayetteville team consisted of 43 full-time staff members. Of the authorized employees, 96.71 % of the labor hours are dedicated to the Fayetteville facilities and 3.29 % labor hours are dedicated to other Jacobs projects. There were 8 open positions and the Regional Support team assisted with work order backlog, capital improvement projects, and various special projects. The Employee Vacancy and Project Status Report is presented in Appendix C. 1.2 Compliance The Noland and West Side facilities met all discharge permit parameter limits throughout July. There were no sanitary sewer overflows reported at the facilities or at the lift stations. The July effluent discharge limitations and data summary tables are presented in Appendices A-B. 1.3 Financials The month ended with a negative financial variance. The non-labor and labor expenses were under budget. The July YTD projected budget variance is ($314,313) as seen in the Budget Performance Table below. Table 1.1: Year to Date Budget Month Labor Non-Labor Year-to-Date Variation Jan-24 ($36,460.00) ($50,471.00) ($86,931.00) -13.31% Feb-24 ($29,211.00) ($88,680.00) ($117,891.00) -9.03% Mar-24 ($62,968.00) ($65,541.00) ($128,509.00) -6.06% Apr-24 ($89,237.00) ($47,411.00) ($136,648.00) -4.93% May-24 ($127,142.00) ($56,296.00) ($183,438.00) -5.62% Jun-24 ($157,251.00) ($62,649.00) ($219,900.00) -5.61% Jul-24 ($194,529.00) ($119,783.00) ($314,313.00) -6.88% Aug-24 0.00% Sep-24 0.00% Oct-24 0.00% Nov-24 0.00% Dec-24 0.00% Minimum ($194,529.00) ($119,783.00) ($314,313.00) -13.31% Maximum ($29,211.00) ($47,411.00) ($86,931.00) -4.93% July 2024 Monthly Report Jacobs - Fayetteville iii 2. Plant Operations The Noland and West Side Water Resource Recovery Facilities (WRRF) met all discharge permit parameter limits within the National Pollutant Discharge Elimination System (NPDES) permits. Details of effluent quality and influent loadings are shown in Appendices A and B. The summary tables for effluent permit parameter limitations were updated to reflect July effluent discharge limitations. The average temperature for the month was 78.5 °F and rainfall accumulation was 4.61 inches. Note: temperature and rainfall obtained from https://www.weather.gov/wrh/Climate?wfo=tsa 2.1 Noland The Noland facility treated a total of 149.35 MG (Million Gallons) of influent. The average daily flow was 4.81 MGD (Million Gallons per day). The peak flow was recorded on the 22nd at 10.56 MGD. With the repairs to aerator #3, levels of DO (dissolved oxygen) are more accurately maintained in the Aeration Basin. Return Activated Sludge pumps are being installed to help maintain the MLSS target. 2.2 West Side The West Side Facility treated a total of 260.13 MG of influent and the average daily flow was 8.12 MGD. Peak flow was recorded on the 22nd at 11.51 MGD. Sludge pump #2 stator and rotor were replaced. BOD (biochemical oxygen demand) loading decreased by another 7% from the previous month. Online dissolved oxygen probes received new brackets and the probe was adjusted to read more accurately. Each probe was calibrated, and adjustments were made to raise the effluent gate 1-inch to allow more oxygen to remain in the bio unit for treatment. July 2024 Monthly Report Jacobs - Fayetteville iv 3. Laboratory Whole Effluent Toxicity (WET) samples were collected for the Goose Creek outfall at West Side. Samples were sent to Cove Environmental in Stillwater, OK for analysis. Goose Creek passed WET testing for both species; Ceriodaphnia Dubia, water flea, for survival and reproduction and the Pimephales promelas, fathead minnow, for growth assessment, showing neither lethal nor sublethal effects, in the full dilution series outlined in the permit of 100%, 74%, 56%, 42%, 32% and 0%. WET testing was halted for the White River outfall at the Noland facility. The test could not be completed for the full week of toxicity testing due to failure of the ozone disinfection equipment and subsequent interruption of effluent discharge. The test was rescheduled for the following week and samples were collected and sent to Cove Environmental in Stillwater, OK for analysis. White River passed WET testing for both species; Ceriodaphnia Dubia, water flea, for survival and reproduction and Pimephales promelas, fathead minnow, for growth assessment, showing neither lethal nor sublethal effects, in the full dilution series outlined in the permit of 96%, 72%, 54%, 41%, 30%, and 0%. As required by Title 40 of the Code of Federal Regulations (CFR) Part 503 Biosolids Rule to meet Class A Exceptional Quality certification, belt filter press cake samples were collected from Noland and West Side for the analysis of metals (arsenic, cadmium, chromium, copper, lead, mercury, molybdenum, nickel, selenium, and zinc) and percent total solids. All results were statistically within scope and exhibited no unusual trends. Quarterly 40 CFR Part 122 Appendix D Table III samples were collected at both facilities for the analysis of cyanide, phenolics, and metals (antimony, arsenic, beryllium, cadmium, chromium, copper, lead, low level mercury, nickel, selenium, silver, thallium, and zinc). Samples were collected from the Noland influent, White River effluent, West Side influent, and Goose Creek effluent and sent to Eurofins for analysis. Data results were statistically within scope and exhibited no unusual trends. July 2024 Monthly Report Jacobs - Fayetteville v 4. Biosolids Management Site 4.1 Biosolids Operations During the month of July, the WRRF’s produced 1,322 wet tons of belt-filter-pressed biosolids. All biosolids produced were partially dried in solar houses or processed through the Griffin sludge dryer. Roughly 523 partially dried tons were disposed of at the landfill. By partially drying biosolids through the solar houses and the Griffin sludge dryer, the BMS managed to remove an additional 799 tons of water before landfilling. It’s estimated that $38,504 were saved in tipping fees. The landfill expense for July is estimated at $25,203. 4.2 Water Treatment Residuals In mid-July, Beaver Water notified BMS of their full lagoon status. BWD requested an increase to land application efforts at the BMS to further support their wasting needs. The BMS responded by agreeing to land apply extra loads throughout the week (up to 6 daily) and extra loads during the weekend (up to 8 daily) when compliant conditions are present. The response generated a new monthly record in land application. In total, the BMS team applied 1,606 tons of residuals. August is anticipated to be another land application record month. 4.3 Hay Harvest The BMS team completed its first cutting in July and hay sales have started to increase. The second harvest is ready to be cut and we anticipate harvesting half of the site’s forage in August. July 2024 Monthly Report Jacobs - Fayetteville vi 4.4 Dryer Operation The BMS team continued 24/7 operation of the Griffin sludge dryer. The temperature issues experienced last month continued in July. Griffin Residuals contracted Multi-Craft Construction to clean the dryer’s cooling system. MCC cleaned the outside of the condenser coil, flushed the inside of the coil, cleaned inside the cooling tower, and cooling tower media. Once completed, dryer operation commenced. Unfortunately, the condenser high temperature alarms continued. To proceed with dryer operation, the temperature must be lowered from 350ºF to a range between 275-325ºF. The lower temperature allows operation without the sludge dryer alarm and subsequent automatic shutdown. This overheating issue has a dramatic effect on material throughput. Without the ability to operate the dryer at an optimal temperature, the final product does not meet the compliance requirements of Class A Fertilizer. To ensure Class A Fertilizer compliance requirements are met, the BMS team must re-dry previously dried material. 4.5 Revenue The staff land applied 1,606 tons of WTR this month generating $51,500 in revenue. There were also sales of hay and fertilizer for an overall revenue total of $67,390. Table 4.1: Revenue generated from the BMS Product Tons Sold/Received Revenue Generated Hay 217 $15,411 Fertilizer 24 $479 Water Treatment Residuals 1,606 $51,500 July 2024 Monthly Report Jacobs - Fayetteville vii 5. Maintenance 5.1 Noland During a routine inspection of the belt filter presses, it was discovered through thermal imaging that one of the bearings on belt filter press #1 was showing a much higher temperature than normal. The bearing was taken apart, and the shaft seal showed signs of damage from the bearing failure. The PM (Preventive Maintenance) schedule and thermal imaging were implemented for this exact scenario and prevented severe damage to the equipment. The secondary clarifiers at the Noland facility operate using a gravity system and suction pipe to return sludge back to the aeration basin. The suction pipe lowers the water level in the RAS (Return Activated Sludge) box causing a head differential between the water level in the tank and the RAS box. This allows settled solids to be drawn up from the tank floor into the RAS box. The system utilizes gates to restrict or allow flow from a specific clarifier depending on the solids inventory. During normal operations, a gate was observed to be moving, but the solids inventory level was not fluctuating as expected. The gate was removed and found to be in unsatisfactory condition with the metal gate deteriorated along both edges. A temporary fix was attempted to remove the gate from a neighboring clarifier that was not in use at the time. However, the intended replacement was found to be in the same condition. Two new gates were fabricated and installed without issue. 5.2 West Side Sub mixer #13 in the anaerobic zone for West Side basin #3 was replaced due to motor failure. The replacement of the rotor and stator for sludge pump #2 has been completed. The pump is back in service and functioning at full capacity. July 2024 Monthly Report Jacobs - Fayetteville viii 5.3 Lift Stations A new pump was installed at lift station #32 Silverthorne. Delivery of the pump followed a completed service and repair. Lift station wet well cleaning continues with the services of Badger Inc. July 2024 Monthly Report Jacobs - Fayetteville ix 5.4 Key Performance Indicators/Measures Figure 5-1: Labor Hours by Work Order Type Figure 5-2: Work Order Count by Type 75 11 588 268 501 106 0 administrative corrective maintenance emergency corrective maintenance non emergency corrective maintenance from pm/pdm preventive maintenance project safety 17, 1%4, 0% 58, 4% 31, 2% 1402, 92% 6, 1% 0, 0%administrative corrective maintenance emergency corrective maintenance non emergency corrective maintenance from pm/pdm preventive maintenance project safety July 2024 Monthly Report Jacobs - Fayetteville x 5.5 Capital Improvement Projects (CIP) 5.5.1 Planned Projects 5.5.1.1 Lift Station Lift station #5 Gregg Avenue pump #2 was commissioned in July. Jack Tyler Engineering provided the new pump after submitting a successful bid earlier in the year. July 2024 Monthly Report Jacobs - Fayetteville xi 6. Industrial Pretreatment The annual septic waste hauler authorization letters were sent to the haulers for truck licensing by the Washington County Health Department. Monthly surcharge and waste hauler reports were completed and submitted for billing. For revenue generated from the IPP, see Table 6.1 and Figure 19. Table 6.1: Industrial Pretreatment Program (IPP) Revenue Summary REVENUE $102,370.85 Surcharges on June data $1,900.00 Fees from hauled waste accepted in July $0.00 Other fees paid in July $0.00 Fines assessed in July Zero violations for all industrial users Violations on June data July 2024 Monthly Report Jacobs - Fayetteville xii Figure 19: Revenue Generated from the Industrial Pretreatment Program via Surcharges, Fees, and Fines Figure 20: Number of hauled waste loads, by hauler $- $50,000 $100,000 $150,000 $200,000 Revenue Generated Industrial Pretreatment Program 2023 Monthly Surcharge Fees plus Hauled Waste Fees 2024 Monthly Surcharge Fees plus Hauled Waste Fees 0 10 20 30 40 50 60 70 Hauled Waste Summary 2023 APT 2024 APT 2023 BJ 2024 BJ 2023 CIC 2024 CIC 2023 Total 2024 Total July 2024 Monthly Report Jacobs - Fayetteville xiii 7. Safety The primary safety issue faced throughout the month of July was the extreme heat in northwest Arkansas. Real temperatures were regularly in the mid to high 90s Fahrenheit, and heat indices frequently exceeded 100 degrees due to the high humidity. Multiple mitigation efforts were implemented to reduce the risks of heat related illnesses faced by project personnel, including starting shifts an hour earlier at 06:00 to finish before the highest heat of the mid-afternoon. Cooling neck wraps were provided to all staff, along with electrolyte hydration packs and freezer pops. Two new BlackLine 4-gas meters were purchased and received for the Noland facility. These meters integrate with the same existing Cloud monitoring system used by the Ozone monitors to allow real-time tracking of air monitoring during confined space entries. A charging and calibration station was setup in the maintenance shop for easy access (see below). As of August 14, 2024, the project has gone 323 days without a recordable incident. July 2024 Monthly Report Jacobs - Fayetteville xiv 8. Woolsey Wet Prairie As expected, July was a month of peak activity for vegetation management efforts with Jacobs staff achieving 18 treatment days, out of the 22 available, after accounting for weekends, holidays, and weather. July also reflected a 25% volume increase of herbicide application. While increases of application volumes aren’t necessarily a target goal, in fact decreases of application volumes are long-term goals, this current increase represents treatment improvements that are key driving forces to eventually achieving the highly desirable decreases in over-all application volumes. Sericea lespedeza continues to be the primary focus of July treatment activities, but peak summer growth also presented control needs for additional high- priority invasive species such as Johnsongrass, Himalayan Blackberry, Callery Pear, Thistle, White Sweet Clover, and Reed Canary Grass. First documented at Woolsey Wet Prairie in 2021, Reed Canary Grass continues to present a serious threat to Woolsey Wet Prairie’s long-term biodiversity integrity. This year, literally hundreds of seed-heads were hand removed from a significantly sized, but fortunately single colony, located in the W2 wetland cell. In addition to physical removal of seed heads, and herbicide treatment, staff will be taking steps to deploy physical markers around the colony’s perimeter to improve both future monitoring and treatment efforts to ensure removal of this invasive species from Woolsey Wet Prairie. July’s vegetation management efforts were not limited to Woolsey, nor the Monday – Friday workweek. July weekends have been a great time to recruit family help in harvesting beneficial native wildflower seeds from several home cultivated species, 20 in fact, where seeds are used for improving the native biodiversity of West Side WRRF stormwater Best Management Practice areas and a further investment in Woolsey Wet Prairie’s botanical resiliency. July 2024 Monthly Report Jacobs - Fayetteville xv Appendix A: Noland Effluent Report White River Average Daily Effluent Report Flow CBOD CBOD Load TSS TSS Load Total P Total P Load NH3 NH3 Load D.O (min)pH (min)pH (max) Fecal Coliform Geo Mean Month MGD mg/L Lbs mg/L Lbs mg/L Lbs mg/L Lbs mg/L SU SU CFU/100 mL Permit Limit Jun-Sept 4.5 473 5.0 525 1.0 105.0 1.0 105 >6.9 >6.0 <9.0 200 Jul 2024 4.929 2.2 95 <1.0 <44 0.3 12.4 0.04 1.9 8.3 7.6 7.8 <48 Jun 2024 5.656 <2.3 <109 <1.3 <63 <0.2 <7.8 0.05 2.3 13.8 7.6 7.8 79 May 2024 7.314 <2.0 <129 1.9 119 0.5 32.7 0.04 2.5 12.7 7.5 7.8 82 Apr 2024 8.180 2.4 160 <1.4 <93 <0.1 <9.4 0.03 2.0 12.9 7.5 7.7 30 Mar 2024 6.832 3.8 191 <3.1 <167 0.2 10.8 0.05 2.7 15.0 7.4 7.7 <36 Feb 2024 5.231 4.4 194 4.5 191 0.2 9.5 0.35 19.4 13.2 6.7 7.6 >510 Jan 2024 4.539 2.3 85 <1.7 <64 <0.1 <4.5 0.30 11.7 16.1 7.4 7.6 27 Dec 2023 4.478 <2.1 <78 <1.7 <61 <0.1 <5.4 0.05 1.7 16.8 7.4 7.7 <22 Nov 2023 5.484 2.4 113 <2.2 <103 0.3 12.1 0.07 3.0 14.5 7.4 7.6 112 Oct 2023 5.419 2.8 126 <1.8 <83 <0.2 <9.5 <0.05 <2.2 14.3 7.4 7.6 <122 Sep 2023 5.459 2.2 100 <1.1 <52 0.1 6.7 0.04 1.7 14.4 7.5 7.6 33 Aug 2023 4.579 2.8 112 <1.0 <42 <0.2 <6.3 <0.03 <1.0 7.9 7.5 7.7 127 Jul 2023 3.949 3.3 119 <1.3 <50 0.4 12.9 0.06 2.0 12.6 7.1 7.7 63 White River Average Daily Effluent - Minerals Report TDS TDS Load Sulfate Total As SO4 Sulfate Total Load As SO4 Chlorides NO3+NO2 (Nitrate+Nitrite) Month mg/L Lbs/dy mg/L Lbs/day mg/L mg/L Permit Limit Jun - Sept 500 52,542 119 12505 report report Jul 2024 347 16,317 54 2,527 42.0 4.8 Jun 2024 345 19,164 65 3,068 37.0 4.5 May 2024 303 23,526 51 3,943 32.0 1.0 Apr 2024 310 23,164 50 3,674 3.8 Mar 2024 358 14,822 61 2,798 2.0 Feb 2024 323 17,809 57 3,199 2.7 Jan 2024 326 11,390 54 1,954 4.0 Dec 2023 393 16,327 62 2,435 7.2 Nov 2023 335 15,702 54 2,531 6.9 Oct 2023 353 16,829 49 2,289 4.4 Sep 2023 332 14,655 49 2,007 1.1 Aug 2023 383 18,164 68 3,335 1.4 Jul 2023 362 11,092 61 1,948 6.5 Appendix A-1: Noland Influent Report Flow Hydraulic Loading CBOD Load Orangic Loading TSS Loading TSS Loading PO4 Loading PO4 Loading NH3 Loading NH3 Loading Month MGD %Lbs %Lbs %Lbs %Lbs % Design Annual Average 12.60 29,666 23,198 765 2,250 Jul 2024 4.84 38.4 9,919 33.4 8,400 36.2 164 21.4 762 33.9 Jun 2024 5.58 44.3 16,582 55.9 8,949 38.6 205 26.8 929 41.3 May 2024 7.68 60.9 12,214 41.2 8,523 36.7 192 25.1 787 35.0 Apr 2024 5.82 46.2 10,174 34.3 7,410 31.9 184 24.1 1,043 46.3 Mar 2024 5.77 45.8 14,098 47.5 8,489 36.6 277 36.3 1,129 50.2 Feb 2024 6.00 47.6 14,626 49.3 10,281 44.3 207 27.1 944 41.9 Jan 2024 7.00 55.5 20,414 68.8 8,983 38.7 255 33.4 1,002 44.5 Dec 2023 5.29 42.0 14,114 47.6 10,303 44.4 208 27.3 805 35.8 Nov 2023 4.62 36.7 13,933 47.0 9,536 41.1 215 28.1 928 41.3 Oct 2023 4.68 37.1 11,217 37.8 7,126 30.7 201 26.2 873 38.8 Sep 2023 4.90 38.9 15,241 51.4 8,882 38.3 222 29.0 1,047 46.5 Aug 2023 4.49 35.6 12,396 41.8 8,602 37.1 201 26.3 840 37.3 Jul 2023 4.42 35.0 10,145 34.2 7,494 32.3 165 21.6 662 29.4 Appendix B: West Side Effluent Report Goose Creek Average Daily Effluent Report Flow CBOD CBOD Load TSS TSS Load Total P Total P Load NH3 NH3 Load DO (min)pH (min)pH (max) Fecal Coliform Geo Mean Month MGD mg/L Lbs mg/L Lbs mg/L Lbs mg/L Lbs mg/L SU SU MPN/100 mL Permit Limit June - Sept 5.3 442.0 10 834 1.0 83.4 1.0 83.4 >6.9 >6.0 <9.0 200 Jul 2024 8.2 <2.5 <129.0 1.0 69 <0.1 4.4 <0.0 <2.8 8.5 7.5 7.7 <14 Jun 2024 8.1 <2.0 <157.3 1.0 68 0.2 12.4 <0.0 <1.9 8.7 7.3 7.7 <13 May 2024 11.0 <1.9 <133.5 1.0 94 0.3 26.4 <0.0 <1.9 9.2 7.4 7.6 <6 Apr 2024 9.2 <1.9 <138.2 1.0 79 0.1 7.4 <0.1 <7.8 9.6 7.4 7.7 <7 Mar 2024 9.1 <1.9 <132.2 1.1 91 0.1 7.5 <0.0 <2.5 10.0 7.3 7.6 <5 Feb 2024 9.3 <1.9 <138.6 1.1 84 <0.1 7.6 <0.1 <4.9 10.1 7.3 7.5 <5 Jan 2024 10.1 <1.9 <161.7 1.0 84 <0.1 5.1 0.3 25.7 10.6 7.1 7.6 <5 Dec 2023 8.4 <1.9 <149.0 1.0 72 <0.1 4.7 0.1 8.0 10.1 7.4 7.6 <12 Nov 2023 8.1 <1.9 <129.7 1.0 69 <0.1 3.5 0.1 5.4 9.4 7.4 7.7 <13 Oct 2023 8.3 <2.0 <149.6 1.0 70 <0.1 4.5 <0.1 <3.9 8.9 7.2 7.7 <9 Sep 2023 8.3 <1.9 <177.6 1.0 68 <0.1 3.5 <0.1 <5.7 8.6 7.4 7.7 <8 Aug 2023 8.1 <2.3 <136.2 1.0 69 <0.1 3.7 <0.1 <10.9 8.5 7.4 7.8 <11 Jul 2023 8.0 <2.0 <170.5 1.0 65 0.1 6.1 <0.0 <1.9 8.6 7.3 7.8 <13 Appendix B-1: West Side Influent Report Flow Hydraulic Loading BOD Load Orangic Loading TSS Load TSS Loading Total P Load PO4 Loading NH3 Load NH3 Loading Month MGD %Lbs %Lbs %Lbs %Lbs % Design Annual Average 10.0 14,595 14,595 584 1,918 Jul 2024 8.2 81.6 9,122 62.5 11,515 78.9 237 40.7 1,248 65.1 Jun 2024 8.1 81.3 10,253 70.3 11,452 78.5 248 42.5 1,231 64.2 May 2024 11.0 109.8 12,969 88.9 16,404 112.4 288 49.4 1,282 66.9 Apr 2024 9.2 92.5 11,290 77.4 13,539 92.8 277 47.4 1,398 72.9 Mar 2024 9.1 91.5 11,480 78.7 11,496 78.8 289 49.6 1,353 70.5 Feb 2024 9.3 92.9 11,001 75.4 11,743 80.5 276 47.3 1,418 74.0 Jan 2024 10.1 100.5 10,964 75.1 10,328 70.8 275 47.2 1,263 65.9 Dec 2023 8.4 83.8 11,806 80.9 15,655 107.3 287 49.1 1,231 64.2 Nov 2023 8.1 81.1 12,297 84.3 12,911 88.5 269 46.0 1,394 72.7 Oct 2023 8.3 83.3 11,632 79.7 15,514 106.3 274 46.8 1,363 71.1 Sep 2023 8.3 82.6 10,683 73.2 12,584 86.2 281 48.1 1,377 71.8 Aug 2023 8.1 81.4 10,442 71.5 12,891 88.3 275 47.1 1,312 68.4 Jul 2023 8.0 79.9 9,164 62.8 14,506 99.4 250 42.9 1,253 65.3 Department Job Title Employee Name Fayetteville % FTE Admin Project Manager Ryan Harrold 82.00% Admin Assistant Project Manager Travis Patton 100.00% Admin Health, Safety, Compliance Professional Mike Muenich 70.00% Admin Project Coordinator Brandi Miller-DeWeese 90.00% Admin Administrative Assistant Christy Taylor 100.00% Admin Administrative Assistant Kassandra Foster 100.00% Admin Project Specialist Vacant 100.00% BMS BMS Supervisor Peter Burrow 100.00% BMS Lead Operator Mike Reed 100.00% BMS Operator I David Dajani 100.00% BMS Equipment Operator Charlie Boger 100.00% BMS Equipment Operator Jerime Dickey 100.00% BMS Operator In Training Robert Donnell 100.00% BMS Operator In Training Christopher Cox 100.00% BMS Operator In Training Jeremy Johnson 100.00% BMS Operator In Training Zaylen Bryant 100.00% BMS Operator In Training Zayvien Dominguez 100.00% BMS Operator In Training Vacant 100.00% Admin Process & Compliance Supervisor Thom Vinson 90.00% Admin Environmental Specialist Jeff Hickle 100.00% LAB Laboratory Director Donna McChristian 90.00% LAB Industrial Pretreatment Coordinator John Byrd 100.00% LAB Lead Laboratory Analyst Matt Benton 100.00% LAB Laboratory Analyst Walter Chodor 100.00% Maint Maintenance Supervisor Vacant 100.00% Maint Planner Scheduler John Jarvela 100.00% Maint Lead Mechanic Buddy Carter 95.00% Maint Lead Electrician Vacant 70.00% Maint Electrician Brian Daniels 100.00% Maint Mechanic Michael Spohn 100.00% Maint Mechanic Paul Goolsby 100.00% Maint Mechanic Rick Dollarhide 100.00% Maint Mechanic in Training Broc Burus 100.00% Maint Mechanic in Training Caleb Wheeler 100.00% Maint Mechanic in Training Dalton Bridges 100.00% Maint Utility Worker - Temp Vacant 100.00% Maint Utility Worker - Temp Vacant 100.00% Operations Operations Supervisor Shawn Santellanes 100.00% Operations Lead Operator Vacant 100.00% Operations Operator I Anthony Ramsfield 100.00% Operations Operator I Justin Sweeney 100.00% Operations Operator Chandler Smothers 100.00% Operations Operator Brittney Doyel 100.00% Operations Operator In Training Ezra Maglothin 100.00% Operations Operator In Training Stephen Jewell 100.00% Operations Operator In Training Jaden Mericle 100.00% Operations Operator In Training Vacant 100.00% SCADA Instruct and Control Tech Christopher Merrit 100.00% SCADA Instrument & Control Tech Pat Cooley 95.00% SCADA Instrument & Control Tech Preston Jones 100.00% SCADA Information & Operational Tech James Mason 50.00% Authorized Positions = 51.0 Filled Positions = 43.0 Filled FTE's= 41.6 REGIONAL SUPPORT and SPECIAL PROJECTS (Performed in scope) Area Reason Name Hours SCADA Scada Support Scada Regional Support 27 Maintenance Maintenance, Reporting, and IT Related Activities Various Regional Staff 41.25 BMS Dryer Installation Project Staff & Regional Support 0 Noland Master Plan Data Request and Sampling Planning Staff 0 Appendix C. Employee Vacancy and Project Status Report Noland Water Resource Recovery Facility Master Plan Report (DRAFT) P R E P A R E D F O R City of Fayetteville Arkansas August 2024 Prepared by: 2049 E. Joyce Blvd, Suite 400 Fayetteville, Arkansas 72703 August 2024 Garver Project No. 20W01162 Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Garver Project No. 20W01162 Page 2 Engineer’s Certification I hereby certify that this Master Plan Report, associated with the Noland Water Resource Recovery Facility, was prepared by Garver under my direct supervision for the City of Fayetteville. ___________________________________________ Christopher R. Buntin, PE State of Arkansas PE License No. 12716 ___________________________________________ Kamyar Sardari, PhD, PE State of Arkansas PE License No. 20764 THIS DOCUMENT IS RELEASED FOR THE PURPOSE OF INTERIM REVIEW UNDER THE AUTHORITY OF CHRISTOPHER R. BUNTIN PE#12716, AUGUST 2024. IT IS NOT TO BE USED FOR CONSTRUCTION, BIDDING, OR PERMITTING PURPOSES. THIS DOCUMENT IS RELEASED FOR THE PURPOSE OF INTERIM REVIEW UNDER THE AUTHORITY OF KAMYAR SARDARI PE#20764, AUGUST 2024. IT IS NOT TO BE USED FOR CONSTRUCTION, BIDDING, OR PERMITTING PURPOSES. Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Garver Project No. 20W01162 Page 8 Executive Summary The Master Plan for the City of Fayetteville’s Noland Water Resource Recovery Facility (WRRF) was developed by Garver to identify immediate needs as well as planning for the facility’s needs over the next 20 years. The population of the Noland WRRF service area is expected to approximately double over the planning period, so capacity improvements, along with current condition concerns, were evaluated as part of the Master Plan. Garver applied an eight-step approach to determine what improvements would be needed over the planning period. This approach included a project kickoff meeting to establish goals of the master plan, a review of historical data and existing plant condition, planning criteria and model development, a needs assessment, technical evaluations and gap analysis, and capital improvements planning (CIP). The full eight-step approach is illustrated by Figure ES-1. Figure ES-1: Overview of the Eight-Step Approach to Master Planning Historical data collected from 2017 through 2022 was used to analyze the flow and loadings entering and leaving the plant. The Noland WRRF’s service population and 2020 historical influent average daily flow were used to calculate a per capita water usage of 175 gallon per capita per day (gpcd). This usage rate aligned with the average per capita flow over the 5-year study period (2017 – 2022) and was used to develop the annual average daily flow projections. The Historical Data Review Technical Memorandum (TM) identified the peaking factor for max month flow and the Wastewater Master Plan Update Final Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Garver Project No. 20W01162 Page 9 Report (RJN Group, 2021) recommended the peak hour flow factor. The existing and projected flows at the Noland WRRF used for planning are shown in Figure ES-2. Figure ES-2: Projected Influent Flow Arriving at the Noland WRRF A baseline process model of the Noland WRRF was developed to analyze the existing processes and aid in the development of improvement recommendations. A hydraulic model was used to determine the current hydraulic capacities and identify critical hydraulic control points throughout the plant. These models are documented in the Planning Criteria Summary and Modeling TM. The existing conditions of the plant are documented in the Asset Condition and Operational Assessment TM, and the Gap Analysis TM identified any required additional capacity over the planning period. The technical evaluations present the recommended improvement approach for the major treatment processes at the plant. These recommendations are combined in the facility buildout layouts and were split into individual CIP elements to assess criticalities and construction dependencies. These CIPs were used to recommend a prioritization of implementation of the improvements. For example, CIP elements with high prioritization generally included critical assets, which have high likelihoods and consequences of failure and need to be discussed in the near future to avoid further risk. Elements with lower prioritization generally included capacity-based improvements, which can be implemented in the future as influent flow and loadings increase. 0 2 4 6 8 10 12 2020 2025 2030 2035 2040 2043 Pr o j e c t e d F l o w A r r i v i n g a t t h e N o l a n d W R R F ( M G D ) Historical Data Projected Flow - Per Capita Approach Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Garver Project No. 20W01162 Page 10 The recommended improvements were categorized into three phases: Phase 1 (0 to 5 years), Phase 2 (5 to 10 years), and Phase 3 (10 to 20 years). It is recommended that the City immediately perform a large Phase 1 project to address critical assets. The remaining improvements can be completed using successively phased projects or a continuous approach where a fixed number of projects are implemented each year based on the annual budget. The recommended breakdown of CIP elements is presented in Table ES-1, along with their estimated costs in June 2024 dollars. Table ES-1: Breakdown of CIP Elements by Phase/Timeline Phase 1 (0 to 5 years) Phase 2 (5 to 10 years) Phase 3 (10 to 20 years) • Upgrade screening conveyance • Add septage receiving station • Add influent Parshall flume • Replace existing mechanical fine screens • Expand screening facility and add one mechanical coarse screen • Upgrade odor control • Replace grit removal • Add electrical building and Influent Pump Station (IPS) 1 with four pumps • Rehab BNR trains with diffused aeration system • Add electrical and blower building with five blowers • Rehabilitate secondary clarifiers • New disk filter facility • Rehabilitate ozone system • Perform disinfection study • Upgrade dewatering building’s HVAC system • Replace oldest belt filter press (BFP) unit • Add grit bypass channel • Replace two RAS pumps • Add one disk filter unit • Add parallel UV disinfection system with four banks • Rehabilitate two sludge holding tanks with diffused aeration system • Rehabilitate old blower building with two new blowers • Add third blower to old blower building • Replace other BFP unit, conveyor, and polymer storage system • Add a third BFP unit and additional polymer storage • Upgrade to SCADA fiber star • Add a second generator • Add two mechanical fine screens and one mechanical coarse screen • Replace two existing bar screens with mechanical coarse screens • Expand IPS capacity • Add sixth blower to BNR blower building • Add splitter box • Add RAS/WAS pump station • Add BNR basin • Add supplemental carbon feed building • Convert old sand filters to a coagulation/flocculation facility • Add one bank to parallel UV system Total Cost1: $78,092,000 Total Cost1: $22,096,000 Total Cost1: $52,305,000 Notes: 1. Includes legal, bidding, and engineering design and construction services. A buildout site layout and model of the recommended improvements for the Noland WRRF are shown in Figure ES-3 and Figure ES-4. F O X H U N T E R R D BIOLOGICAL NUTRIENT REMOVAL BASINS PRIMARY CLARIFIER NO. 1 PRIMARY CLARIFIER NO. 2 GENERATOR BUILDING SLUDGE HOLDING TANK (DECOMMISSIONED) BELT FILTER PRESS PUMP STATION FILTERS INFLUENT PUMP STATION NO. 1 ADMINISTRATION BUILDING OZONE BUILDING STORAGE BUILDING HEADWORKS BUILDING SOLIDS DEWATERING BUILDING OZONE DISINFECTION AEROBIC DIGESTER (DECOMMISSIONED) AEROBIC DIGESTER (DECOMMISSIONED) EXISTING RAS/WAS PUMP STATION POST AERATION MAIN SWITCH NEW BIOLOGICAL NUTRIENT REMOVAL BASIN BLOWER FACILITY NEW RAS/WAS PUMP STATION SUPPLEMENTAL CARBON STORAGE & FEED STATION NEW DISK FILTER FACILITY NEW ALUM STORAGE AND FEED FACILITYREHABILITATED SECONDARY CLARIFIERS ADDITIONAL BFP INSTALLED NEW BLOWERS FOR SLUDGE TANKS REHABILITATED SLUDGE HOLDING TANKS NEW INFLUENT PUMP STATION REHABILITATED INFLUENT PUMP STATION NO. 2 NEW GRIT BYPASS CHANNEL HEADWORKS BUILDING EXPANSION NEW INFLUENT PARSHALL FLUME UV DISINFECTION ELECTRICAL BUILDING NEW SPLITTER BOX ELECTRICAL BUILDING NEW COAGULATION/ FLOCCULATION FACILITY NEW ODOR CONTROL NEW VAC UNLOADING AREA (IN FEET) 0 30'60'120'180' TH I S D O C U M E N T I S R E L E A S E D F O R T H E PU R P O S E O F I N T E R I M R E V I E W U N D E R T H E AU T H O R I T Y O F : F I R S T M . L A S T , P. E . # O N J U N E 2 0 2 4 . I T IS N O T T O B E U S E D F O R C O N S T R U C T I O N , BI D D I N G , O R P E R M I T T I N G P U R P O S E S . THIS DOCUMENT, ALONG WITH THE IDEAS AND DESIGNS CONVEYED HEREIN, SHALL BE CONSIDERED INSTRUMENTS OF PROFESSIONAL SERVICE AND ARE PROPERTY OF GARVER, LLC. ANY USE, REPRODUCTION, OR DISTRIBUTION OF THIS DOCUMENT, ALONG WITH THE IDEAS AND DESIGN CONTAINED HEREIN, IS PROHIBITED UNLESS AUTHORIZED IN WRITING BY GARVER, LLC OR EXPLICITLY ALLOWED IN THE GOVERNING PROFESSIONAL SERVICES AGREEMENT FOR THIS WORK. © 2024 GARVER, LLC CHECKED BY: DATE: JOB NO.: DESIGNED BY: BAR IS ONE INCH ON ORIGINAL DRAWING IF NOT ONE INCH ON THIS SHEET, ADJUST SCALES ACCORDINGLY. 0 1" DRAWING NUMBER SHEET NUMBER JUNE 2024 20W01162 DRAWN BY: RE V DA T E DE S C R I P T I O N BY CI T Y O F F A Y E T T E V I L L E FA Y E T T E V I L L E , A R FA Y E T T E V I L L E W W T P M A S T E R PL A N PR E L I M I N A R Y D E S I G N - N O T FO R C O N S T R U C T I O N Fi l e : L: \ 2 0 2 0 \ 2 0 W 0 1 1 6 2 - F a y e t t e v i l l e W W T P M a s t e r P l a n \ D r a w i n g s \ F A Y W - 0 5 - C 1 0 2 - S I . d w g La s t S a v e : 7/ 1 0 / 2 0 2 4 1 0 : 2 3 A M La s t s a v e d b y : KL B a s s La s t p l o t t e d b y : Ba s s , K a t y L . Pl o t S t y l e : AE C m o n o . c t b Pl o t S c a l e : 1: 2 . 5 8 4 9 Pl o t D a t e : 8/ 1 3 / 2 0 2 4 9 : 3 3 A M Pl o t t e r u s e d : No n e --- --- 05-C102 04 PROPOSED SITE PLAN - OVERVIEW --- Figure ES-3 Phase 1 (0 to 5 years) Phase 2 (5 to 10 years) Phase 3 (10 to 20 years) NO L A N D W R R F M A S T E R P L A N Noland Water Resource Recovery Facility Master Plan Report (DRAFT) Garver Project No. 20W01162 Page 12 Figure ES-4: Buildout Rendering of Noland WRRF Dewatering Improvements Biological Nutrient Removal Basin Rehabilitation Disinfection Improvements Future Biological Nutrient Removal Basin Secondary Clarifier Rehabilitation Future Splitter Box and Supplemental Carbon Feed Building Future Blower Building Future Disk Filter Facility and Alum Future Alum Facility Sludge Holding Tank Rehabilitation Digester Demolition and Future Influent Pump Station and Electrical Building Headworks Improvements Screening Facility Expansion Old Administration Building Demolition Future RAS/WAS Pump Station Sludge Pumps Replacement AGREEMENT For PROFESSIONAL ENGINEERING SERVICES Between CITY OF FAYETTEVILLE, ARKANSAS AND RJN GROUP, INC. Page 1 of 10 THIS AGREEMENT is made as of , 2024, by and between City of Fayetteville, Arkansas, acting by and through its Mayor (hereinafter called CITY OF FAYETTEVILLE) and ENGINEER (hereinafter called ENGINEER). CITY OF FAYETTEVILLE from time to time requires professional engineering services in connection with the evaluation, design, and/or construction supervision of capital improvement projects. Therefore, CITY OF FAYETTEVILLE and ENGINEER in consideration of their mutual covenants agree as follows: ENGINEER shall serve as CITY OF FAYETTEVILLE’s professional engineering consultant in those assignments to which this Agreement applies and shall give consultation and advice to CITY OF FAYETTEVILLE during the performance of ENGINEER’s services. All services shall be performed under the direction of a professional engineer registered in the State of Arkansas and qualified in the particular field. SECTION 1 - AUTHORIZATION OF SERVICES 1.1 Services on any assignment shall be undertaken only upon written Authorization of CITY OF FAYETTEVILLE and agreement of ENGINEER. 1.2 Assignments may include services described hereafter as Basic Services or as Additional Services of ENGINEER. 1.3 Changes, modifications or amendments in scope, price or fees to this contract shall not be allowed without a formal contract amendment approved by the Mayor and the City Council in advance of the change in scope, costs, fees, or delivery schedule. SECTION 2 - BASIC SERVICES OF ENGINEER 2.1 Perform professional services in connection with the Project as hereinafter stated. 2.1.1 The Scope of Services to be furnished by ENGINEER during the Project is included in Appendix A attached hereto and made part of this Agreement. 2.2 ENGINEER shall coordinate their activities and services with the CITY OF FAYETTEVILLE. ENGINEER and CITY OF FAYETTEVILLE agree that ENGINEER has full responsibility for the engineering services. SECTION 3 - RESPONSIBILITIES OF CITY OF FAYETTEVILLE 3.1 CITY OF FAYETTEVILLE shall, within a reasonable time, so as not to delay the services of ENGINEER. 3.1.1 Provide full information as to CITY OF FAYETTEVILLE’s requirements for the Project. Page 2 of 10 3.1.2 Assist ENGINEER by placing at ENGINEER’s disposal all available information pertinent to the assignment including previous reports and any other data relative thereto. 3.1.3 Assist ENGINEER in obtaining access to property reasonably necessary for ENGINEER to perform its services under this Agreement. 3.1.4 Examine all studies, reports, sketches, cost opinions, proposals, and other documents presented by ENGINEER and render in writing decisions pertaining thereto. 3.1.5 The Utilities Director is the CITY OF FAYETTEVILLE’s project representative with respect to the services to be performed under this Agreement. The Utilities Director shall have complete authority to transmit instructions, receive information, interpret and define CITY OF FAYETTEVILLE’s policies and decisions with respect to materials, equipment, elements and systems to be used in the Project, and other matters pertinent to the services covered by this Agreement. 3.1.6 CITY OF FAYETTEVILLE and/or its representative will review all documents and provide written comments to ENGINEER in a timely manner. SECTION 4 - PERIOD OF SERVICE 4.1 This Agreement will become effective upon the first written notice by CITY OF FAYETTEVILLE authorizing services hereunder. 4.2 The provisions of this Agreement have been agreed to in anticipation of the orderly progress of the Project through completion of the services stated in the Agreement. ENGINEER will proceed with providing the authorized services immediately upon receipt of written authorization from CITY OF FAYETTEVILLE. Said authorization shall include the scope of the services authorized and the time in which the services are to be completed. The anticipated schedule for this project is included as Appendix A. SECTION 5 - PAYMENTS TO ENGINEER 5.1 The maximum not-to-exceed amount authorized for this Agreement is $_267,380.00________. The CITY OF FAYETTEVILLE shall compensate ENGINEER based on a Unit Price or Lump Sum basis as described in Appendix A. 5.2 Statements 5.2.1 Monthly statements for each calendar month shall be submitted to CITY OF FAYETTEVILLE or such parties as CITY OF FAYETTEVILLE may designate for professional services consistent with ENGINEER’s normal billing schedule. Once established, the billing schedule shall be maintained throughout the duration of the Project. Applications for payment shall be made in accordance with a format to be developed by ENGINEER and approved by CITY OF FAYETTEVILLE. Applications for payment shall be accompanied each month by the updated project schedule as the basis for determining the value earned as the work is accomplished. Final payment for professional services shall be made upon CITY OF FAYETTEVILLE’s approval and acceptance with the satisfactory completion of the study and report for the Project. Page 3 of 10 5.3 Payments 5.3.1 All statements are payable upon receipt and due within thirty (30) days. If a portion of ENGINEER’s statement is disputed by CITY OF FAYETTEVILLE, the undisputed portion shall be paid by CITY OF FAYETTEVILLE by the due date. CITY OF FAYETTEVILLE shall advise ENGINEER in writing of the basis for any disputed portion of any statement. CITY OF FAYETTEVILLE will make reasonable effort to pay invoices within 30 days of date the invoice is approved, however, payment within 30 days is not guaranteed. 5.4 Final Payment 5.4.1 Upon satisfactory completion of the work performed under this Agreement, as a condition before final payment under this Agreement, or as a termination settlement under this Agreement, ENGINEER shall execute and deliver to CITY OF FAYETTEVILLE a release of all claims against CITY OF FAYETTEVILLE arising under or by virtue of this Agreement, except claims which are specifically exempted by ENGINEER to be set forth therein. Unless otherwise provided in this Agreement or by State law or otherwise expressly agreed to by the parties to this Agreement, final payment under this Agreement or settlement upon termination of this Agreement shall not constitute a waiver of CITY OF FAYETTEVILLE’s claims against ENGINEER or his sureties under this Agreement or applicable performance and payment bonds, if any. SECTION 6 - GENERAL CONSIDERATIONS 6.1 Insurance 6.1.1 During the course of performance of these services, ENGINEER will maintain (in United States Dollars) the following minimum insurance coverages: Type of Coverage Limits of Liability Workers’ Compensation Statutory Employers’ Liability $500,000 Each Accident Commercial General Liability Bodily Injury and $1,000,000 Combined Single Limit Property Damage Automobile Liability: Bodily Injury and $1,000,000 Combined Single Limit Property Damage Professional Liability Insurance $1,000,000 Each Claim ENGINEER will provide to CITY OF FAYETTEVILLE certificates as evidence of the specified insurance within ten days of the date of this Agreement and upon each renewal of coverage. 6.1.2 CITY OF FAYETTEVILLE and ENGINEER waive all rights against each other and their officers, directors, agents, or employees for damage covered by property insurance during and after the completion of ENGINEER’s services. Page 4 of 10 6.2 Professional Responsibility 6.2.1 ENGINEER will exercise reasonable skill, care, and diligence in the performance of ENGINEER’s services and will carry out its responsibilities in accordance with customarily accepted professional engineering practices. CITY OF FAYETTEVILLE will promptly report to ENGINEER any defects or suspected defects in ENGINEER’s services of which CITY OF FAYETTEVILLE becomes aware, so that ENGINEER can take measures to minimize the consequences of such a defect. CITY OF FAYETTEVILLE retains all remedies to recover for its damages caused by any negligence of ENGINEER. 6.3 Cost Opinions and Projections 6.3.1 Cost opinions and projections prepared by ENGINEER relating to construction costs and schedules, operation and maintenance costs, equipment characteristics and performance, and operating results are based on ENGINEER’s experience, qualifications, and judgment as a design professional. Since ENGINEER has no control over weather, cost and availability of labor, material and equipment, labor productivity, construction Contractors’ procedures and methods, unavoidable delays, construction Contractors’ methods of determining prices, economic conditions, competitive bidding or market conditions, and other factors affecting such cost opinions or projections, ENGINEER does not guarantee that actual rates, costs, performance, schedules, and related items will not vary from cost opinions and projections prepared by ENGINEER. 6.4 Changes 6.4.1 CITY OF FAYETTEVILLE shall have the right to make changes within the general scope of ENGINEER’s services, with an appropriate change in compensation and schedule only after Fayetteville City Council approval of such proposed changes and, upon execution of a mutually acceptable amendment or change order signed by the Mayor of the CITY OF FAYETTEVILLE and the duly authorized officer of ENGINEER. 6.5 Termination 6.5.1 This Agreement may be terminated in whole or in part in writing by either party in the event of substantial failure by the other party to fulfill its obligations under this Agreement through no fault of the terminating party, provided that no termination may be effected unless the other party is given: 6.5.1.1 Not less than ten (10) calendar days written notice (delivered by certified mail, return receipt requested) of intent to terminate, 6.5.1.2 An opportunity for consultation with the terminating party prior to termination. 6.5.2 This Agreement may be terminated in whole or in part in writing by CITY OF FAYETTEVILLE for its convenience, provided that ENGINEER is given: 6.5.2.1 Not less than ten (10) calendar days written notice (delivered by certified mail, return receipt requested) of intent to terminate, 6.5.2.2 An opportunity for consultation with the terminating party prior to termination. Page 5 of 10 6.5.3 If termination for default is effected by CITY OF FAYETTEVILLE, an equitable adjustment in the price provided for in this Agreement shall be made, but 6.5.3.1 No amount shall be allowed for anticipated profit on unperformed services or other work, 6.5.3.2 Any payment due to ENGINEER at the time of termination may be adjusted to cover any additional costs to CITY OF FAYETTEVILLE because of ENGINEER’s default. 6.5.4 If termination for default is effected by ENGINEER, or if termination for convenience is effected by CITY OF FAYETTEVILLE, the equitable adjustment shall include a reasonable profit for services or other work performed. The equitable adjustment for any termination shall provide for payment to ENGINEER for services rendered and expenses incurred prior to the termination, in addition to termination settlement costs reasonably incurred by ENGINEER relating to commitments which had become firm prior to the termination. 6.5.5 Upon receipt of a termination action under Paragraphs 6.5.1 or 6.5.2 above, ENGINEER shall: 6.5.5.1 Promptly discontinue all affected work (unless the notice directs otherwise), 6.5.5.2 Deliver or otherwise make available to CITY OF FAYETTEVILLE all data, drawings, specifications, reports, estimates, summaries and such other information and materials as may have been accumulated by ENGINEER in performing this Agreement, whether completed or in process. 6.5.6 Upon termination under Paragraphs 6.5.1 or 6.5.2 above CITY OF FAYETTEVILLE may take over the work and may award another party an agreement to complete the work under this Agreement. 6.5.7 If, after termination for failure of ENGINEER to fulfill contractual obligations, it is determined that ENGINEER had not failed to fulfill contractual obligations, the termination shall be deemed to have been for the convenience of CITY OF FAYETTEVILLE. In such event, adjustments of the agreement price shall be made as provided in Paragraph 6.5.4 of this clause. 6.6 Delays 6.6.1 In the event the services of ENGINEER are suspended or delayed by CITY OF FAYETTEVILLE or by other events beyond ENGINEER’s reasonable control, ENGINEER shall be entitled to additional compensation and time for reasonable costs incurred by ENGINEER in temporarily closing down or delaying the Project. 6.7 Rights and Benefits 6.7.1 ENGINEER’s services will be performed solely for the benefit of CITY OF FAYETTEVILLE and not for the benefit of any other persons or entities. 6.8 Dispute Resolution 6.8.1 Scope of Paragraph: The procedures of this Paragraph shall apply to any and all disputes between CITY OF FAYETTEVILLE and ENGINEER which arise from, or in any way are Page 6 of 10 related to, this Agreement, including, but not limited to the interpretation of this Agreement, the enforcement of its terms, any acts, errors, or omissions of CITY OF FAYETTEVILLE or ENGINEER in the performance of this Agreement, and disputes concerning payment. 6.8.2 Exhaustion of Remedies Required: No action may be filed unless the parties first negotiate. If timely Notice is given under Paragraph 6.8.3, but an action is initiated prior to exhaustion of these procedures, such action shall be stayed, upon application by either party to a court of proper jurisdiction, until the procedures in Paragraphs 6.8.3 and 6.8.4 have been complied with. 6.8.3 Notice of Dispute 6.8.3.1 For disputes arising prior to the making of final payment promptly after the occurrence of any incident, action, or failure to act upon which a claim is based, the party seeking relief shall serve the other party with a written Notice. 6.8.3.2 For disputes arising within one year after the making of final payment, CITY OF FAYETTEVILLE shall give ENGINEER written Notice at the address listed in Paragraph 6.14 within thirty (30) days after occurrence of any incident, accident, or first observance of defect or damage. In both instances, the Notice shall specify the nature and amount of relief sought, the reason relief should be granted, and the appropriate portions of this Agreement that authorize the relief requested. 6.8.4 Negotiation: Within seven days of receipt of the Notice, the Project Managers for CITY OF FAYETTEVILLE and ENGINEER shall confer in an effort to resolve the dispute. If the dispute cannot be resolved at that level, then, upon written request of either side, the matter shall be referred to the President of ENGINEER and the Mayor of CITY OF FAYETTEVILLE or his designee. These officers shall meet at the Project Site or such other location as is agreed upon within 30 days of the written request to resolve the dispute. 6.9 CITY OF FAYETTEVILLE represents that it has sufficient funds or the means of obtaining funds to remit payment to ENGINEER for services rendered by ENGINEER. 6.10 Publications 6.10.1 Recognizing the importance of professional development on the part of ENGINEER’s employees and the importance of ENGINEER’s public relations, ENGINEER may prepare publications, such as technical papers, articles for periodicals, and press releases, pertaining to ENGINEER’s services for the Project. Such publications will be provided to CITY OF FAYETTEVILLE in draft form for CITY OF FAYETTEVILLE’s advance review. CITY OF FAYETTEVILLE shall review such drafts promptly and provide CITY OF FAYETTEVILLE’s comments to ENGINEER CITY OF FAYETTEVILLE may require deletion of proprietary data or confidential information from such publications, but otherwise CITY OF FAYETTEVILLE will not unreasonably withhold approval. The cost of ENGINEER’s activities pertaining to any such publication shall be for ENGINEER’s account. 6.11 Indemnification 6.11.1 CITY OF FAYETTEVILLE agrees that it will require all construction Contractors to indemnify, defend, and hold harmless CITY OF FAYETTEVILLE and ENGINEER from and Page 7 of 10 against any and all loss where loss is caused or incurred or alleged to be caused or incurred in whole or in part as a result of the negligence or other actionable fault of the Contractors, or their employees, agents, Subcontractors, and Suppliers. 6.12 Ownership of Documents 6.12.1 All documents provided by CITY OF FAYETTEVILLE including original drawings, CAD drawings, estimates, field notes, and project data are and remain the property of CITY OF FAYETTEVILLE. ENGINEER may retain reproduced copies of drawings and copies of other documents. 6.12.2 Engineering documents, computer models, drawings, specifications and other hard copy or electronic media prepared by ENGINEER as part of the Services shall become the property of CITY OF FAYETTEVILLE when ENGINEER has been compensated for all Services rendered, provided, however, that ENGINEER shall have the unrestricted right to their use. ENGINEER shall, however, retain its rights in its standard drawings details, specifications, databases, computer software, and other proprietary property. Rights to intellectual property developed, utilized, or modified in the performance of the Services shall remain the property of ENGINEER. 6.12.3 Any files delivered in electronic medium may not work on systems and software different than those with which they were originally produced. ENGINEER makes no warranty as to the compatibility of these files with any other system or software. Because of the potential degradation of electronic medium over time, in the event of a conflict between the sealed original drawings/hard copies and the electronic files, the sealed drawings/hard copies will govern. 6.13 Notices 6.13.1 Any Notice required under this Agreement will be in writing, addressed to the appropriate party at the following addresses: CITY OF FAYETTEVILLE’s address: 113 West Mountain Street Fayetteville, Arkansas 72701 ENGINEER’s address: 14755 Preston Rd, Ste 710 Dallas, TX 75254 Page 8 of 10 6.14 Successor and Assigns 6.14.1 CITY OF FAYETTEVILLE and ENGINEER each binds himself and his successors, executors, administrators, and assigns to the other party of this Agreement and to the successors, executors, administrators, and assigns of such other party, in respect to all covenants of this Agreement; except as above, neither CITY OF FAYETTEVILLE nor ENGINEER shall assign, sublet, or transfer his interest in the Agreement without the written consent of the other. 6.15 Controlling Law 6.15.1 This Agreement shall be subject to, interpreted and enforced according to the laws of the State of Arkansas without regard to any conflicts of law provisions. 6.16 Entire Agreement 6.16.1 This Agreement represents the entire Agreement between ENGINEER and CITY OF FAYETTEVILLE relative to the Scope of Services herein. Since terms contained in purchase orders do not generally apply to professional services, in the event CITY OF FAYETTEVILLE issues to ENGINEER a purchase order, no preprinted terms thereon shall become a part of this Agreement. Said purchase order document, whether or not signed by ENGINEER, shall be considered as a document for CITY OF FAYETTEVILLE’s internal management of its operations. SECTION 7 - SPECIAL CONDITIONS 7.1 Additional Responsibilities of ENGINEER 7.1.1 CITY OF FAYETTEVILLE’s review, approval, or acceptance of design drawings, specifications, reports and other services furnished hereunder shall not in any way relieve ENGINEER of responsibility for the technical adequacy of the work. Neither CITY OF FAYETTEVILLE’s review, approval or acceptance of, nor payment for any of the services shall be construed as a waiver of any rights under this Agreement or of any cause of action arising out of the performance of this Agreement. 7.1.2 ENGINEER shall be and shall remain liable, in accordance with applicable law, for all damages to CITY OF FAYETTEVILLE caused by ENGINEER’s negligent performance of any of the services furnished under this Agreement except for errors, omissions or other deficiencies to the extent attributable to CITY OF FAYETTEVILLE or CITY OF FAYETTEVILLE-furnished data. 7.1.3 ENGINEER’s obligations under this clause are in addition to ENGINEER’s other express or implied assurances under this Agreement or State law and in no way diminish any other rights that CITY OF FAYETTEVILLE may have against ENGINEER for faulty materials, equipment, or work. 7.2 Remedies 7.2.1 Except as may be otherwise provided in this Agreement, all claims, counterclaims, disputes and other matters in question between CITY OF FAYETTEVILLE and ENGINEER arising Page 9 of 10 out of or relating to this Agreement or the breach thereof will be decided in a court of competent jurisdiction within Arkansas. 7.3 Audit: Access to Records 7.3.1 ENGINEER shall maintain books, records, documents and other evidence directly pertinent to performance on work under this Agreement in accordance with generally accepted accounting principles and practices consistently applied in effect on the date of execution of this Agreement. ENGINEER shall also maintain the financial information and data used by ENGINEER in the preparation of support of the cost submission required for any negotiated agreement or change order and send to CITY OF FAYETTEVILLE a copy of the cost summary submitted. CITY OF FAYETTEVILLE, the State or any of their authorized representatives shall have access to all such books, records, documents and other evidence for the purpose of inspection, audit and copying during normal business hours. ENGINEER will provide proper facilities for such access and inspection. 7.3.2 Records under Paragraph 7.3.1 above shall be maintained and made available during performance on assisted work under this Agreement and until three years from the date of final payment for the project. In addition, those records which relate to any controversy arising out of such performance, or to costs or items to which an audit exception has been taken, shall be maintained and made available until three years after the date of resolution of such appeal, litigation, claim or exception. 7.3.3 This right of access clause (with respect to financial records) applies to: 7.3.3.1 Negotiated prime agreements: 7.3.3.2 Negotiated change orders or agreement amendments in excess of $10,000 affecting the price of any formally advertised, competitively awarded, fixed price agreement: 7.3.3.3 Agreements or purchase orders under any agreement other than a formally advertised, competitively awarded, fixed price agreement. However, this right of access does not apply to a prime agreement, lower tier subagreement or purchase order awarded after effective price competition, except: 7.3.3.3.1 With respect to record pertaining directly to subagreement performance, excluding any financial records of ENGINEER; 7.3.3.3.2 If there is any indication that fraud, gross abuse or corrupt practices may be involved; 7.3.3.3.3 If the subagreement is terminated for default or for convenience. 7.4 Covenant Against Contingent Fees 7.4.1 ENGINEER warrants that no person or selling agency has been employed or retained to solicit or secure this Agreement upon an agreement of understanding for a commission, percentage, brokerage or continent fee, excepting bona fide employees or bona fide established commercial or selling agencies maintained by ENGINEER for the purpose of securing business. For breach or violation of this warranty, CITY OF FAYETTEVILLE shall have the right to annul this Agreement without liability or at its discretion, to deduct from the Page 10 of 10 contract price or consideration, or otherwise recover, the full amount of such commission, percentage, brokerage, or contingent fee. 7.5 Gratuities 7.5.1 If CITY OF FAYETTEVILLE finds after a notice and hearing that ENGINEER or any of ENGINEER’s agents or representatives, offered or gave gratuities (in the form of entertainment, gifts or otherwise) to any official, employee or agent of CITY OF FAYETTEVILLE, in an attempt to secure an agreement or favorable treatment in awarding, amending or making any determinations related to the performance of this Agreement, CITY OF FAYETTEVILLE may, by written notice to ENGINEER terminate this Agreement. CITY OF FAYETTEVILLE may also pursue other rights and remedies that the law or this Agreement provides. However, the existence of the facts on which CITY OF FAYETTEVILLE bases such finding shall be in issue and may be reviewed in proceedings under the Remedies clause of this Agreement. 7.5.2 In the event this Agreement is terminated as provided in Paragraph 7.5.1, CITY OF FAYETTEVILLE may pursue the same remedies against ENGINEER as it could pursue in the event of a breach of the Agreement by ENGINEER As a penalty, in addition to any other damages to which it may be entitled by law, CITY OF FAYETTEVILLE may pursue exemplary damages in an amount (as determined by CITY OF FAYETTEVILLE) which shall be not less than three nor more than ten times the costs ENGINEER incurs in providing any such gratuities to any such officer or employee. 7.6 Arkansas Freedom of Information Act 7.6.1 City contracts and documents, including internal documents and documents of subcontractors and sub-consultants, prepared while performing City contractual work are subject to the Arkansas Freedom of Information Act (FOIA). If a Freedom of Information Act request is presented to the CITY OF FAYETTEVILLE, ENGINEER will do everything possible to provide the documents in a prompt and timely manner as prescribed in the Arkansas Freedom of Information Act (A.C.A. §25-19-101 et seq.). Only legally authorized photocopying costs pursuant to the FOIA may be assessed for this compliance. IN WITNESS WHEREOF, CITY OF FAYETTEVILLE, ARKANSAS by and through its Mayor, and ENGINEER, by its authorized officer have made and executed this Agreement as of the day and year first above written. CITY OF FAYETTEVILLE, ARKANSAS ENGINEER By : By: Mayor, Lioneld Jordan PRINTED NAME & TITLE OF PERSON SIGNING ATTEST: By: Title: City Clerk END OF AGREEMENT FOR PROFESSIONAL ENGINEERING SERVICES Sr. Vice President ATTACHMENT A- SCOPE OF SERVICES RJN will perform the following scope of services to plan, ascertain methods of inspection, determine the level of effort, and develop costs estimates for assessing the condition of thirteen sections of critical waterlines, totaling approximately 47.3 miles of pipes. Table 1 below provides details for each pipeline section and a summary of the pipe materials. Table 1 – Pipeline Section Details Pipeline Section Size Material Length (miles) 1 Beaver Water to Joyce 42" PCCP 9.890 2 Beaver Water to Joyce 36" DIP 9.670 3 Joyce & Crossover to Kessler 36" PCCP, DIP, Unknown 10.070 4 Joyce to Township 36" DIP 1.800 5 Township to Huntsville 24" DIP 3.100 6 Crossover to Old Wire 36" DIP 0.910 7 Old Wire (Gulley Park) to North Street 36" DIP 1.590 8 North Street to Huntsville 30" CIP, DIP, Unknown 1.946 9 Old Wire to Markham Hill 24" CIP, DIP, PVC, Unknown 4.513 10 Huntsville to Pump Station 24" DIP, Unknown 0.859 11 Pump Station Road to School Avenue 24" CIP, DIP 1.450 12 School to Custer 24" CIP, DIP 0.310 13 Custer to Markham 24" CIP, DIP, Unknown 1.226 Total 47.334 Pipe Material as a Percentage of Total Pipe Length CIP ~9% DIP ~55% PCCP ~35% PVC ~0% Unknown ~1% RJN will develop a strategy to perform condition assessment inspections to determine the structural integrity of the selected critical waterlines. RJN proposes a multi-task approach starting with a “Health Check” of the pipelines. The Health Check is a process that examines the details and parameters of the pipeline to determine what type of assessment process and/or inspection technology is best suited for the application. The proposed strategy is further described in the following tasks: 1. Pipeline Health Check a. RJN will determine what condition assessment technologies are best suited for assessing and evaluating the integrity of the pipelines. This will be accomplished by performing a thorough review of the pipeline’s repair history, operating parameters, and existing environment conditions. b. Specific tasks of the Health Check will include: i. Review of the pipeline’s as-built drawings. ii. Review of the GIS information and attributes related to the selected pipelines including age, material, design class, and manufacturer. iii. Review of any map books associated with the pipelines. iv. Review of historical and current pipeline operating conditions including: 1. Working average and maximum pressure ranges. 2. Minimum and maximum flow rates. v. Review of leak and break history. vi. Review of other maintenance history. vii. Perform staff interviews. viii. Determine inspection limitations (e.g. Can the pipeline be depressurized?). ix. Identify potential insertion and extraction points along the pipelines for the possible use of in-line inspection tools. c. RJN will recommend the preferred options for assessing the condition of the pipelines. The recommendations will detail the expected level effort and cost associated with each option, as well as a summary of the data sets that each option will provide. d. Although the use of in-line inspection tools is non-destructive in nature, their use poses certain risks, such as the tool getting stuck in the pipeline, getting lost in the distribution system, or obstructing the flow in the pipe. Although these risks are not likely to occur, RJN will identify and develop contingency plans to mitigate the risk and deal with the consequences. e. Field Investigations. i. RJN will conduct site visits to ascertain and confirm existing site condition, take photographs, validate GIS data, verify survey information, and identify critical areas and constraints. RJN will report any discrepancies in GIS or as-built data. ii. RJN field crews will confirm the existence of any appurtenance along the pipelines such as isolation valves, blow-off valves, air release valves, and fire hydrants. iii. RJN assumes that City staff will be available during field investigations/walkthroughs to provide background information on the existing assets and known issues. 2. Technology Evaluations and Access Coordination a. RJN will evaluate various technologies to determine the best technology for the condition assessment. Multiple technologies will be considered depending on site conditions and accessibility to the pipelines, as well as the cost and effort required to utilize them. The value of the data sets obtained from each technology will be weighed against the overall cost. b. RJN will evaluate technologies that provide leak detection and/or condition assessment (i.e. pipe integrity). These technologies may include, but not be limited to acoustic, internal visual/CCTV, electromagnetic, ultrasonic, pulsed eddy current, and pulsed wave technologies. c. RJN will finalize suitable insertion and extraction points along the pipelines. 3. Determining Inspection Site Preparation and Restoration Needs a. RJN will outline the work necessary and estimate the costs to prepare the pipeline for inspection, including installation of appurtenances required for inserting and retrieving in- line tools and sensors. b. RJN will outline the work necessary and the expected cost to restore every insertion and retrieval site to near original condition. 4. Perform a Desktop Analysis Prioritization RJN will prioritize the selected pipelines for subsequent condition assessment inspections. The prioritization will be based on a desktop analysis of existing data and interviews with City engineers and operation staff. a. RJN will meet with the appropriate City staff to review and collect pertinent information and data, to include shapefiles with related attributes: i. Potable water pipeline, including attributes such as size, age, material, nominal pressure, etc. ii. Sanitary and stormwater facilities such as pump stations and storage tanks. iii. Geographical features such as waterways, contours, and forestry. iv. Critical customers such as industries, hospitals, schools, and universities. v. Streets, roadways, and railroad tracks. vi. Other water utilities, namely sanitary and stormwater sewers. vii. Gas and electric power utilities. b. RJN will meet with City staff to collect repair and maintenance records for the selected pipelines. The scope assumes that the City has a Computerized Maintenance Management System (CMMS) containing these records electronically. RJN will request a download of the records in the appropriate format. c. RJN will perform a GIS geospatial analysis to determine the condition and criticality of every pipeline segment. For condition, the analysis will consider age, material, and maintenance and repair history. For criticality, the analysis will account for pipe size, critical customers, proximity to water ways and other sensitive areas, proximity to major roadways and railroad tracks, and proximity to commercial and business centers. d. RJN will submit a Desktop Analysis Prioritization Report detailing the results of the analysis and establishing the order, or sequence of pipeline inspections based on the risk factor assigned to each pipeline. 5. Soil Corrosivity Testing RJN will perform corrosivity soil testing along the pipeline. Corrosive soils can react with and corrode pipe materials, such as concrete and ferrous metals. PCCP and metal pipes are affected by sulfates, chlorides, and other adverse minerals in the soil. a. RJN will develop a Soil Testing Protocol outlining the sampling intervals and locations along the pipelines. b. RJN will obtain the samples and deliver them to a soils lab for testing to determine the extent of the soil corrosivity. c. RJN will submit a report detailing the results of the soil corrosivity tests, and any pertinent recommendations. d. RJN will factor in the results of the soil corrosivity testing into the Desktop Analysis Prioritization (Task 4 above). e. RJN would bill this work on a Unit Price Basis, at $440.00 per sample. This amount would cover subtasks a through d listed above. Until work begins on the project it is very difficult to estimate the number of samples that should be obtained. Initially, it is estimated that there will be 100 samples taken. As the project advances, RJN will refine this estimate, and will communicate the revised recommended quantity to the City, in advance of taking the samples. ADDITIONAL TASKS NOT INCLUDED IN THE SCOPE RJN proposes the following task for consideration, which is not included in the Scope of Services or the price of the project. Task 6. Pipelines Cathodic Protection Testing RJN will identify, locate, and test the cathodic protection (CP) stations along the pipelines. a. RJN will review as-built drawings and identify the location of CP stations along the pipelines. b. RJN will visit each CP station and test as follows: i. Test the pipe-to-soil voltage potential by comparing it to a copper sulfate half-cell. ii. Test the continuity of the pipe. iii. Test the voltage output of the anode. iv. Measure the current flow from the anode to the pipe. c. RJN will submit a report detailing the CP stations, the result of the tests, and any pertinent recommendations. ATTACHMENT B- PROPOSED SCHEDULE RJN is prepared to start work immediately upon receiving a Notice To Proceed from the City. RJN will complete the work within six (6) months of the Notice To Proceed date. ATTACHMENT C- PRICING Pricing for the Water Line Condition Assessment Pre-Planning project is as follows: Pricing Terms for Invoicing: Lump Sum, Percent Complete Not-To-Exceed Total Cost: $267,380.00 COST SCHEDULE Task Unit Price Units Fee LUMP SUM ITEMS Project Management and Administration Lump Sum 1 $24,054.00 Desktop Reconnaissance Lump Sum 1 $45,644.00 Field Reconnaissance Lump Sum 1 $51,179.00 Working Meetings Lump Sum 1 $25,268.00 Technology Eval’s, Access Coordination Lump Sum 1 $42,105.00 Determining Inspection Site Preparation and Restoration Needs Lump Sum 1 $23,377.00 Desktop Analysis Prioritization Lump Sum 1 $11,753.00 LUMP SUM TOTAL: $223,380.00 UNIT PRICE ITEMS Soil Corrosivity Testing (as needed) $440.00 100 $44,000.00 UNIT PRICE TOTAL: $44,000.00 TOTAL: $267,380.00 Proposal Option This Proposal can be amended to include additional work upon joint approval by the City and RJN. 14755 Preston Road, Suite 710 | Dallas, Texas 75254-7898 | (972) 437-4300 www.rjn.com August 12, 2024 Corey Granderson, P.E. Utilities Engineer City of Fayetteville Water and Sewer Services 2435 S Industrial Drive Fayetteville, AR 72701 SUBJECT: PROPOSAL FOR PROFESSIONAL ENGINEERING SERVICES WATER LINE CONDITION ASSESSMENT PRE-PLANNING Dear Mr. Granderson: RJN Group, Inc. is pleased to submit this proposal to the City of Fayetteville for Water Line Condition Assessment Pre-planning Services. RJN, established in 1975, is a professional engineering consulting firm focused on providing innovative engineering solutions and field services. With more than 90% of our clients being municipalities and public utilities, we are uniquely qualified for this project. Key Project Goals and Objectives The primary goal of this project is to lay the groundwork for a strategic, efficient program of condition assessments of the City’s water mains that are 24-inch and larger. RJN will perform services to plan, ascertain methods of inspection, determine the level of effort, and develop cost estimates for assessing the condition of thirteen sections of critical waterlines, totaling approximately 47.3 miles of pipes. The project will include the following:  Desktop reconnaissance  Field reconnaissance  Working meetings  Technology evaluations, access coordination  Determining inspection site preparation and restoration needs  Desktop analysis prioritization  Soil Corrosivity Testing Following the completion of this project, the City will utilize the info and recommendations from the project to develop a corresponding program of water line assessments. ■■ Water Line Condition Assessment Pre-Planning, City of Fayetteville, AR | Page 2 PROJECT EXPERIENCE In the past 49 years, RJN has assessed 288,000,000 feet of water pipeline across the country. This has included tasks such as focused leak detection, maintenance inspections, pressure monitoring, risk and resiliency planning, and building asset inventory and management programs. ASSURING QUALITY AND SAFETY Quality Assurance RJN is committed to providing quality deliverables. The completion of these inspections is critical in providing actionable results for the City. RJN has built data review processes that ensure that all data is accurate. RJN’s internal Quality Control tools, as well as our corporate training and Quality Assurance processes in place, will ensure that the project will provide value for the City. Safety As an employee-owned firm, RJN’s commitment to the safety of our employees, City staff, and the public is paramount. RJN demonstrates that commitment to safety in our internally developed and audited safety program where our goal is to have all field staff, engineers, and project managers “RJN Safety Certified.” Every project follows RJN’s health and safety guidelines when completing any field work. PRICE AND SCHEDULE SUMMARY This project will be invoiced on a unit price and lump sum, percent complete basis for a total not-to- exceed fee of $267,380.00. RJN will complete the project within six (6) months of an Agreement and Notice To Proceed. Complete Scope of Services, Pricing, Schedule, and Map are provided in the following exhibits:  Exhibit A – Scope of Services  Exhibit B – Pricing  Exhibit C – Schedule  Exhibit D – Map We are looking forward to the opportunity to work with the City on this important project. It is our pleasure to submit this proposal to you. Please feel free to contact Stephen Jeffus at (214) 240-4412 if you would like to discuss this proposal or have any questions. Sincerely, Stephen Jeffus, P.E. Daniel Jackson, P.E. Water Innovations Manager Senior Vice President (214) 240-4412 (214) 529-6608 KǁŶĞƌ^ŝƚĞ͗'ƵůůĞLJZŽĂĚtĂƚĞƌdĂŶŬ͕ϯϮϲϱ'ƵůůĞLJZŽĂĚ͕&ĂLJĞƚƚĞǀŝůůĞ͕ZϳϮϳϬϯ dĞŶĂŶƚ^ŝƚĞ͗DĂůůĞƚĂͬϱϬϬϬϬϬϭϮϰϳ   SIXTH AMENDMENT TO WATER TOWER ATTACHMENT COMMUNICATIONS SITE AGREEMENT This Sixth Amendment to Water Tower Attachment Communications Site Agreement (“Amendment”) is entered into this ______ day of _______________, 20____, by and between City of Fayetteville ("OWNER"), with a mailing address of 113 West Mountain Street, Fayetteville, Arkansas 72701, and Alltel Corporation d/b/a Verizon Wireless ("TENANT"), with its principal office located at One Verizon Way, Mail Stop 4AW100, Basking Ridge, New Jersey 07920. The OWNER and TENANT are at times collectively referred to hereinafter as the “Parties” or individually as the “Party”. WHEREAS, OWNER and TENANT, as successor in interest to Fayetteville MSA Limited Partnership, are Parties to that certain Water Tower Attachment Communications Site Agreement dated October 20, 1999, as amended by that certain First Amendment to Water Tower Attachment Communications Site Agreement dated January 19, 2010, as amended by that certain Second Amendment to Water Tower Attachment Communications Site Agreement dated November 16, 2010, as amended by that certain Third Amendment to Water Tower Attachment Communications Site Agreement dated July 19, 2011, as amended by that certain Fourth Amendment to Water Tower Attachment Communications Site Agreement dated October 1, 2019, and as amended by that certain Fifth Amendment to Water Tower Attachment Communications Site Agreement dated October 4, 2022 (collectively, the “Agreement”), pursuant to which OWNER leases to TENANT a portion of OWNER's property located at 3265 Gulley Road, Fayetteville, Arkansas 72703; and WHEREAS, the Parties desire to amend the Agreement to modify the TENANT’S equipment as set forth herein. NOW THEREFORE, for good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the Parties agree as follows: 1. Any capitalized terms used in this Amendment that are not defined herein have the meanings given those terms in the Agreement. 2. OWNER and TENANT agree to modify TENANT’s equipment as described on Exhibit C-4, attached hereto and incorporated herein by reference. 3. Exhibit C-3 of the Agreement is deleted in its entirety and replaced with Exhibit C- 4, attached hereto and incorporated herein by reference. All references to Exhibit C, Exhibit C-1, Exhibit C-2 or Exhibit C-3 in the Agreement are hereafter references to Exhibit C-4. 4. Commencing on the first (1st) day of the month following installation of TENANT’s modified equipment (“Rent Increase Commencement Date”), the monthly rent paid by TENANT to OWNER shall increase by Three Hundred and No/100 Dollars ($300.00). The Parties agree to acknowledge the Rent Increase Commencement Date in writing. 5. OWNER and TENANT each hereby warrant to the other that the person executing this Amendment on behalf of the warranting Party has the full right, power and authority to enter             into, and execute, this Amendment on that Party’s behalf, and that no consent from any other person or entity is necessary as a condition precedent to the legal effect of this Amendment. 6. Except as specifically provided in this Amendment, the Agreement shall remain in full force and effect and shall continue to be binding upon, and enforceable against, OWNER and TENANT in accordance with its terms. All covenants, terms and obligations of the Agreement not modified by this Amendment are hereby ratified and affirmed. The terms and provisions of this Amendment shall control in the event of any inconsistency or discrepancy between the Agreement and this Amendment. [Signature Pages Follow]             IN WITNESS WHEREOF, the Parties have executed this Amendment effective as of the day and year first above written. OWNER: City of Fayetteville By: Printed Name: Title: Date: TENANT: Alltel Corporation d/b/a Verizon Wireless By: Printed Name: Title: Date:                     Exhibit C-4 EQUIPMENT DESCRIPTION Antenna/Tower Equipment: x Three (3) Samsung MT6413-77A Antennas (or like kind) x Six (6) CommScope NHH-65C-R2B antennas (or like kind) x Three (3) Samsung B2/B66A RRH ORAN (RF4439d-25A) (or like kind) x Three (3) Samsung RF4461d-13A (or like kind) x One (1) Raycap RVZDC-6627-PF-48 (or like kind) x Two (2) hybrid cables x Five (5) 7/8" coaxial cables Ground Equipment: x Equipment Shelter: 27’6” x 11’5” x Generator Pad: 4’ x 10’            Certificate Of Completion Envelope Id: DE0F95029FB540B1A2B8A15F19349B2F Status: Completed Subject: Complete with Docusign: Verizon-2056644MallBeta.pdf Source Envelope: Document Pages: 4 Signatures: 1 Envelope Originator: Certificate Pages: 5 Initials: 0 Tanya Turner-Belton AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-08:00) Pacific Time (US & Canada) Tanya.Turner-Belton@VerizonWireless.com IP Address: 192.76.82.73 Record Tracking Status: Original 8/30/2024 6:57:44 AM Holder: Tanya Turner-Belton Tanya.Turner-Belton@VerizonWireless.com Location: DocuSign Signer Events Signature Timestamp Jeremy Katzenberger jeremy.katzenberger@verizonwireless.com Associate Director - Network Real Estate Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 69.78.66.90 Sent: 8/30/2024 7:02:45 AM Viewed: 8/30/2024 7:09:40 AM Signed: 8/30/2024 7:09:46 AM Electronic Record and Signature Disclosure: Accepted: 2/19/2024 3:35:47 PM ID: 66011257-8636-4f27-bff8-01623bd0b249 In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Kathy Taylor ktaylor@foresitetowers.com Security Level: Email, Account Authentication (None) Sent: 8/30/2024 7:02:43 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Kelli Cantey kcantey@bakerdonelson.com Security Level: Email, Account Authentication (None) Sent: 8/30/2024 7:02:43 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Summer Hall smhall@bakerdonelson.com Security Level: Email, Account Authentication (None) Sent: 8/30/2024 7:02:44 AM Viewed: 8/30/2024 7:17:18 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Carbon Copy Events Status Timestamp Thomas Paine thomas.paine@verizonwireless.com Security Level: Email, Account Authentication (None) Sent: 8/30/2024 7:02:44 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 8/30/2024 7:02:44 AM Certified Delivered Security Checked 8/30/2024 7:09:40 AM Signing Complete Security Checked 8/30/2024 7:09:46 AM Completed Security Checked 8/30/2024 7:09:46 AM Payment Events Status Timestamps Electronic Record and Signature Disclosure ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, VBG Network Real Estate (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through the DocuSign system. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to this Electronic Record and Signature Disclosure (ERSD), please confirm your agreement by selecting the check-box next to ‘I agree to use electronic records and signatures’ before clicking ‘CONTINUE’ within the DocuSign system. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. You will have the ability to download and print documents we send to you through the DocuSign system during and immediately after the signing session and, if you elect to create a DocuSign account, you may access the documents for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. Further, you will no longer be able to use the DocuSign system to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically !!"   "!      ! ! #!$ Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through the DocuSign system all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. How to contact VBG Network Real Estate: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: tricsha.fatakia@verizonwireless.com To advise VBG Network Real Estate of your new email address To let us know of a change in your email address where we should send notices and disclosures electronically to you, you must send an email message to us at tricsha.fatakia@verizonwireless.com and in the body of such request you must state: your previous email address, your new email address. We do not require any other information from you to change your email address. If you created a DocuSign account, you may update it with your new email address through your account preferences. To request paper copies from VBG Network Real Estate To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an email to tricsha.fatakia@verizonwireless.com and in the body of such request you must state your email address, full name, mailing address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with VBG Network Real Estate To inform us that you no longer wish to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your signing session, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an email to tricsha.fatakia@verizonwireless.com and in the body of such request you must state your email, full name, mailing address, and telephone number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software The minimum system requirements for using the DocuSign system may change over time. The current system requirements are found here: https://support.docusign.com/guides/signer-guide- signing-system-requirements. Acknowledging your access and consent to receive and sign documents electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please confirm that you have read this ERSD, and (i) that you are able to print on paper or electronically save this ERSD for your future reference and access; or (ii) that you are able to email this ERSD to an email address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format as described herein, then select the check-box next to ‘I agree to use electronic records and signatures’ before clicking ‘CONTINUE’ within the DocuSign system. By selecting the check-box next to ‘I agree to use electronic records and signatures’, you confirm that: x You can access and read this Electronic Record and Signature Disclosure; and x You can print on paper this Electronic Record and Signature Disclosure, or save or send this Electronic Record and Disclosure to a location where you can print it, for future reference and access; and x Until or unless you notify VBG Network Real Estate as described above, you consent to receive exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you by VBG Network Real Estate during the course of your relationship with VBG Network Real Estate. 3DXO-)RUGDQG&RPSDQ\ (DVW%URDG6WUHHW6XLWH &ROXPEXV2+   3-)PRXQW#SDXOMIRUGFRP $QWHQQD0RXQW$QDO\VLV5HSRUWZLWK+DUGZDUH8SJUDGHV DQG30,5HTXLUHPHQWV 0RXQW$QDO\VLV 60$577RRO3URMHFW 3DXO-)RUG3URMHFW $SULO 6LWH,QIRUPDWLRQ6LWH ,' 9=:0$//%(7$ 6LWH1DPH 0$//%(7$ &DUULHU 1DPH 9HUL]RQ:LUHOHVV $GGUHVV 0L1RI+Z\  :RI*XOOH\5G   )D\HWWHYLOOH $UNDQVDV  :DVKLQJWRQ &RXQW\ /DWLWXGH ƒ /RQJLWXGH ƒ 6WUXFWXUH,QIRUPDWLRQ7RZHU7\SH )W:DWHU7DQN 0RXQW7\SH )W &RUUDO )8=(,' $QDO\VLV5HVXOWV )W&RUUDO 3DVV Z+DUGZDUH8SJUDGHV $QWHQQDVDQGHTXLSPHQWWREHLQVWDOOHGLQFRPSOLDQFHZLWK30,5HTXLUHPHQWVRIWKLVPRXQWDQDO\VLV &RQWUDFWRU30,5HTXLUHPHQWV ,QFOXGHGDWWKHHQGRIWKLV0$UHSRUW $YDLODEOH 6XEPLWWHGYLDSRUWDODWKWWSVSPLY]ZVPDUWFRP )RUDGGLWLRQDOTXHVWLRQVDQGVXSSRUWSOHDVHUHDFKRXWWR SPLVXSSRUW#SDXOMIRUGFRP 5HSRUW3UHSDUHG%\.\OH-DPLVRQ(, 04/12/202404/12/20204/12 0RXQW6WUXFWXUDO$QDO\VLV5HSRUW  )W&RUUDO $SULO 6LWH,'9=:0$//%(7$ 3DJH_ ([HFXWLYH6XPPDU\  7KHREMHFWLYHRIWKLVUHSRUWLVWRGHWHUPLQHWKHFDSDFLW\RIWKHDQWHQQDVXSSRUWPRXQWDWWKHVXEMHFWIDFLOLW\IRUWKH ILQDOZLUHOHVVWHOHFRPPXQLFDWLRQVFRQILJXUDWLRQSHUWKHDSSOLFDEOHFRGHVDQGVWDQGDUGV$Q\PRGLILFDWLRQOLVWHG XQGHU6RXUFHVRI,QIRUPDWLRQZDVDVVXPHGFRPSOHWHGDQGZDVLQFOXGHGLQWKLVDQDO\VLV  7KLVDQDO\VLVLVLQFOXVLYHRIWKHPRXQWVWUXFWXUHRQO\DQGGRHVQRWDGGUHVVWKHVWUXFWXUDOFDSDFLW\RIWKHVXSSRUWLQJ VWUXFWXUH7KLVPRXQWLQJIUDPHZDVQRWDQDO\]HGDVDQDQFKRUDWWDFKPHQWSRLQWIRUIDOOSURWHFWLRQ$OOFOLPELQJ DFWLYLWLHVDUHUHTXLUHGWRKDYHDIDOOSURWHFWLRQSODQFRPSOHWHGE\DFRPSHWHQWSHUVRQ   6RXUFHVRI,QIRUPDWLRQ  'RFXPHQW7\SH5HPDUNV 0RXQW0DSSLQJ 6*63URMHFWGDWHG 5DGLR)UHTXHQF\'DWD6KHHW 5)'6  9HUL]RQ5)'6GDWHG   $QDO\VLV&ULWHULD &RGHVDQG6WDQGDUGV $16,7,$+   :LQG3DUDPHWHUV%DVLF:LQG6SHHG 8OWLPDWHVHF*XVW sh>d͗PSK  ,FH:LQG6SHHG VHF*XVW  PSK  'HVLJQ,FH7KLFNQHVV LQ  5LVN&DWHJRU\ ,,,  ([SRVXUH&DWHJRU\ &  7RSRJUDSKLF&DWHJRU\   7RSRJUDSKLF)HDWXUH&RQVLGHUHG +LOO  7RSRJUDSKLF0HWKRG 0HWKRG  *URXQG(OHYDWLRQ)DFWRU.H   6HLVPLF3DUDPHWHUV 66  6   0DLQWHQDQFH3DUDPHWHUV :LQG6SHHG VHF*XVW  PSK  0DLQWHQDQFH/LYH/RDG/Y OEV  0DLQWHQDQFH/LYH/RDG/P OEV  $QDO\VLV6RIWZDUH 5,6$' 9    0RXQW6WUXFWXUDO$QDO\VLV5HSRUW  )W&RUUDO $SULO 6LWH,'9=:0$//%(7$ 3DJH_ )LQDO/RDGLQJ&RQILJXUDWLRQ 7KHIROORZLQJHTXLSPHQWKDVEHHQFRQVLGHUHGIRUWKHDQDO\VLVRIWKHPRXQW 0RXQW (OHYDWLRQ IW  (TXLSPHQW (OHYDWLRQ  IW  4XDQWLW\0DQXIDFWXUHU0RGHO6WDWXV ϭϮϯ͘ϬϬнͬͲ ϭϮϯ͘ϬϬ ϯ ^ĂŵƐƵŶŐ DdϲϰϭϯͲϳϳ ĚĚĞĚ ϲ ŽŵŵƐĐŽƉĞ E,,ͲϲϱͲZϮ ϯ ^ĂŵƐƵŶŐ ϮͬϲϲZZ,KZE;Z&ϰϰϯϵĚͲϮϱͿ ϯ ^ĂŵƐƵŶŐ Z&ϰϰϲϭĚͲϭϯ ϭ ZĂLJĐĂƉ ZsͲϲϲϮϳͲW&Ͳϰϴ  7KHUHFHQWPRXQWPDSSLQJUHSRUWHGH[LVWLQJ293XQLWV,WLVDFFHSWDEOHWRLQVWDOOXSWRDQ\WKUHH  RIWKH293 PRGHOQXPEHUVOLVWHGEHORZDVUHTXLUHGDWDQ\ORFDWLRQRWKHUWKDQWKHPRXQWIDFHZLWKRXWDIIHFWLQJWKHVWUXFWXUDO FDSDFLW\RIWKHPRXQW,I293XQLWVDUHLQVWDOOHGRQWKHPRXQWIDFHDPRXQWUHDQDO\VLVPD\EHUHTXLUHGXQOHVV UHSODFLQJDQH[LVWLQJ293  0RGHO1XPEHU 3RUWV $.$ 5+6'&3)  293 5&'&3)  293 5&'&3)  293 5&'&3)  293 5+6'&3)  293 5+6'&3)  293 6WDQGDUG&RQGLWLRQV   $OOHQJLQHHULQJVHUYLFHVDUHSHUIRUPHGRQWKHEDVLVWKDWWKHLQIRUPDWLRQSURYLGHGWR3DXO-)RUGDQG &RPSDQ\DQGXVHGLQWKLVDQDO\VLVLVFXUUHQWDQGFRUUHFW7KHH[LVWLQJHTXLSPHQWORDGLQJKDVEHHQDSSOLHG DWORFDWLRQVGHWHUPLQHGIURPWKHVXSSOLHGGRFXPHQWDWLRQ$Q\GHYLDWLRQIURPWKHORDGLQJORFDWLRQVVSHFLILHG LQWKLVUHSRUWVKDOOEHFRPPXQLFDWHGWR3DXO-)RUGDQG&RPSDQ\WRYHULI\GHYLDWLRQZLOOQRWDGYHUVHO\ LPSDFWWKHDQDO\VLV   0RXQWVDUHDVVXPHGWRKDYHEHHQSURSHUO\IDEULFDWHGLQVWDOOHGDQGPDLQWDLQHGLQJRRGFRQGLWLRQWZLVW IUHHDQGSOXPELQDFFRUGDQFHZLWKLWVRULJLQDOGHVLJQDQGPDQXIDFWXUHU¶VVSHFLILFDWLRQV 2EYLRXVVDIHW\DQGVWUXFWXUDOLVVXHVGHILFLHQFLHVQRWLFHGDWWKHWLPHRIWKHPRXQWPDSSLQJDQGUHSRUWHGLQ WKH0RXQW0DSSLQJ5HSRUWDUHDVVXPHGWREHFRUUHFWHGDQGGRFXPHQWHGDVSDUWRIWKH30,SURFHVVDQG DUHQRWFRQVLGHUHGLQWKHPRXQWDQDO\VLV  7KH PRXQW DQDO\VLV DQG WKH PRXQW PDSSLQJ DUH QRW D FRQGLWLRQ DVVHVVPHQW RI WKH PRXQW 3URSHU PDLQWHQDQFHDQGFRQGLWLRQDVVHVVPHQWVDUHVWLOOUHTXLUHGSRVWDQDO\VLV   )RUPRXQWDQDO\VHVFRPSOHWHGIURPRWKHUGDWDVRXUFHV LQFOXGLQJQHZUHSODFHPHQWPRXQWV DQGQRW VSHFLILFDOO\PDSSHGLQDFFRUGDQFHZLWKWKH167'6WDQGDUGWKHPRXQWVDUHDVVXPHGWRKDYHEHHQ SURSHUO\IDEULFDWHGLQVWDOOHGDQGPDLQWDLQHGLQJRRGFRQGLWLRQWZLVWIUHHDQGSOXPELQDFFRUGDQFHZLWKLWV RULJLQDOGHVLJQDQGPDQXIDFWXUHU¶VVSHFLILFDWLRQV  $OOPHPEHUFRQQHFWLRQVDUHDVVXPHGWRKDYHEHHQGHVLJQHGWRPHHWRUH[FHHGWKHORDGFDUU\LQJFDSDFLW\ RIWKHFRQQHFWHGPHPEHUXQOHVVRWKHUZLVHVSHFLILHGLQWKLVUHSRUW   7KHIUDPHZDVFKHFNHGXSWRWKHDQFKRUSRLQWRQWKHWDQNVXUIDFH7KHLPSDFWRIWKHSURSRVHGORDGLQJ FRQILJXUDWLRQRQWKHWDQNVKHOODQGZDWHUWDQNVWUXFWXUHVKDOOEHHYDOXDWHGE\WKHVXSSRUWLQJVWUXFWXUH(25 0RXQW6WUXFWXUDO$QDO\VLV5HSRUW  )W&RUUDO $SULO 6LWH,'9=:0$//%(7$ 3DJH_  $OOVHUYLFHVDUHSHUIRUPHGUHVXOWVREWDLQHGDQGUHFRPPHQGDWLRQVPDGHLQDFFRUGDQFHZLWKJHQHUDOO\ DFFHSWHG HQJLQHHULQJ SULQFLSOHV DQG SUDFWLFHV 3DXO - )RUG DQG &RPSDQ\ LV QRW UHVSRQVLEOH IRU WKH FRQFOXVLRQRSLQLRQVDQGUHFRPPHQGDWLRQVPDGHE\RWKHUVEDVHGRQWKHLQIRUPDWLRQVXSSOLHG   6WUXFWXUDO 6WHHO *UDGHV KDYH EHHQ DVVXPHG DV IROORZV LI DSSOLFDEOH XQOHVV RWKHUZLVH QRWHG LQ WKLV DQDO\VLV o &KDQQHO6ROLG5RXQG$QJOH3ODWH $670$ *U  o +66 5HFWDQJXODU    $670 *U%  o3LSH$670$ *U%  o 7KUHDGHG5RG) *U  o%ROWV$670$  'LVFUHSDQFLHVEHWZHHQLQILHOGFRQGLWLRQVDQGWKHDVVXPSWLRQVOLVWHGDERYHPD\UHQGHUWKLVDQDO\VLV LQYDOLGXQOHVVH[SOLFLWO\DSSURYHGE\Paul J. Ford and Company $QDO\VLV5HVXOWV &RPSRQHQW8WLOL]DWLRQ3DVV)DLO 9HUWLFDO3RVW  3DVV 7RS6XSSRUW5DLO 3DVV 0LGGOH6XSSRUW5DLO 3DVV 7RH3ODWH 3DVV 0RXQW3LSH 3DVV  6WUXFWXUH5DWLQJ± &RQWUROOLQJ8WLOL]DWLRQRIDOO&RPSRQHQWV  *5HVXOWVYDOLGDIWHUKDUGZDUHXSJUDGHVQRWHGLQWKH30,5HTXLUHPHQWVDUHLQVWDOOHG  +RUL]RQWDO 6KHDU N  9HUWLFDO 6KHDU N $[LDO N +RUL]RQWDO 0RPHQW NIW  9HUWLFDO 0RPHQW NIW 7RUTXH NIW       5HDFWLRQVSURYLGHGIRUWKHVXSSRUWLQJVWUXFWXUH(25WRHYDOXDWHDVQHHGHG5HDFWLRQLVIRUDVLQJOHQRGH 0RXQW6WHHO (3$ DSHU$16,7,$+6HFWLRQ  ,FH 7KLFNQHVV ,Q  0RXQW3LSHV([FOXGHG0RXQW3LSHV,QFOXGHG )URQW (3$ D 6T)W  6LGH (3$ D 6T)W  )URQW (3$ D 6T)W  6LGH (3$ D 6T)W                 1RWHV  (3$ DYDOXHVOLVWHGDERYHPD\EHXVHGLQWKHDEVHQFHRIPRUHSUHFLVHLQIRUPDWLRQ  (3$ DYDOXHVLQWKHWDEOHDERYHLQFOXGHVHFWRU V  .DIDFWRUVLQFOXGHGLQ (3$ DFDOFXODWLRQV   0RXQW6WUXFWXUDO$QDO\VLV5HSRUW  )W&RUUDO $SULO 6LWH,'9=:0$//%(7$ 3DJH_ 5HTXLUHPHQWV  7KH H[LVWLQJ PRXQWZLOO EH68)),&,(17 IRU WKH ILQDO ORDGLQJ FRQILJXUDWLRQ VKRZQ LQ DWWDFKPHQW  XSRQWKH FRPSOHWLRQRIWKHUHTXLUHPHQWVOLVWHGEHORZ  /ŶƐƚĂůůŶĞǁϵϲ’’WϮ͘Ϭ^d;Ϯ͘ϯϳϱ’’džϬ͘ϭϱϰ’’ͿŵŽƵŶƚƉŝƉĞŝŶƉŽƐŝƚŝŽŶϯŽŶƚŚĞŐĂŵŵĂƐĞĐƚŽƌƉĞƌƚŚĞWƐ͘dŚĞƉŝƉĞ ƉƌŽũĞĐƚŝŽŶƐŚŽƵůĚŵĂƚĐŚƚŚĞĞdžŝƐƚŝŶŐϵϲ’’ůŽŶŐŵŽƵŶƚƉŝƉĞƐ͘hƐĞ;ϮͿŶĞǁst^DZdD^<ͲϭĐƌŽƐƐŽǀĞƌƐĨŽƌƚŚĞ ŝŶƐƚĂůůĂƚŝŽŶ͘   $16,$663ULJJLQJSODQUHYLHZVHUYLFHVFRPSOLDQWZLWKWKHUHTXLUHPHQWVRI$16,7,$DUHDYDLODEOHIRUD &RQVWUXFWLRQ&ODVV,9VLWHRURWKHULIUHTXLUHG6HSDUDWHUHYLHZIHHVZLOODSSO\   $WWDFKPHQWV  ϭ͘ŽŶƚƌĂĐƚŽƌZĞƋƵŝƌĞĚWŽƐƚ/ŶƐƚĂůůĂƚŝŽŶ/ŶƐƉĞĐƚŝŽŶ;WD/ͿZĞƉŽƌƚĞůŝǀĞƌĂďůĞƐ Ϯ͘ŶƚĞŶŶĂWůĂĐĞŵĞŶƚŝĂŐƌĂŵƐ ϯ͘DŽƵŶƚWŚŽƚŽƐ ϰ͘DŽƵŶƚDĂƉƉŝŶŐZĞƉŽƌƚ;ĨŽƌƌĞĨĞƌĞŶĐĞŽŶůLJͿ ϱ͘ŶĂůLJƐŝƐĂůĐƵůĂƚŝŽŶƐ DŽƵŶƚĞƐŬƚŽƉʹWŽƐƚDŽĚŝĨŝĐĂƚŝŽŶ/ŶƐƉĞĐƚŝŽŶ;WD/ͿZĞƉŽƌƚZĞƋƵŝƌĞŵĞŶƚƐ  ŽĐƵŵĞŶƚƐΘWŚŽƚŽƐZĞƋƵŝƌĞĚĨƌŽŵŽŶƚƌĂĐƚŽƌʹWĂƐƐŝŶŐDŽƵŶƚŶĂůLJƐŝƐ WĂƐƐŝŶŐDŽƵŶƚŶĂůLJƐŝƐƌĞƋƵŝƌĞƐĂWD/ĚƵĞƚŽĂŵŽĚŝĨŝĐĂƚŝŽŶŝŶůŽĂĚŝŶŐ͘ (OHFWURQLFSGIYHUVLRQRIWKLVFDQEHGRZQORDGHGDWKWWSVSPLY]ZVPDUWFRP )RUDGGLWLRQDOTXHVWLRQVDQGVXSSRUWSOHDVHUHDFKRXWWRSPLVXSSRUW#SDXOMIRUGFRP ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ  0'* 60$573URMHFW )X]H3URMHFW,'  WƵƌƉŽƐĞʹƚŽƉƌŽǀŝĚĞ^DZddŽŽůƐƚƌƵĐƚƵƌĂůǀĞŶĚŽƌƚŚĞƉƌŽƉĞƌĚŽĐƵŵĞŶƚĂƚŝŽŶŝŶŽƌĚĞƌƚŽĐŽŵƉůĞƚĞ ƚŚĞƌĞƋƵŝƌĞĚDŽƵŶƚĞƐŬƚŽƉƌĞǀŝĞǁŽĨƚŚĞWŽƐƚDŽĚŝĨŝĐĂƚŝŽŶ/ŶƐƉĞĐƚŝŽŶZĞƉŽƌƚ͘ •ŽŶƚƌĂĐƚŽƌŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌŵĂŬŝŶŐĐĞƌƚĂŝŶƚŚĞƉŚŽƚŽƐƉƌŽǀŝĚĞĚĂƐŶŽƚĞĚďĞůŽǁƉƌŽǀŝĚĞ ĐŽŶĨŝƌŵĂƚŝŽŶƚŚĂƚƚŚĞŝŶƐƚĂůůĂƚŝŽŶǁĂƐĐŽŵƉůĞƚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚŝƐWĂƐƐŝŶŐDŽƵŶƚ ŶĂůLJƐŝƐ͘ •ŽŶƚƌĂĐƚŽƌƐŚĂůůƌĞůĂLJĂŶLJĚĂƚĂƚŚĂƚĐĂŶŝŵƉĂĐƚƚŚĞƉĞƌĨŽƌŵĂŶĐĞŽĨƚŚĞŵŽƵŶƚ͕ƚŚŝƐŝŶĐůƵĚĞƐ ƐĂĨĞƚLJŝƐƐƵĞƐ͘  ĂƐĞZĞƋƵŝƌĞŵĞŶƚƐ͗  •/ĨŝŶƐƚĂůůĂƚŝŽŶǁŝůůĐĂƵƐĞĚĂŵĂŐĞƚŽƚŚĞƐƚƌƵĐƚƵƌĞ͕ƚŚĞĐůŝŵďŝŶŐĨĂĐŝůŝƚLJ͕ŽƌƐĂĨĞƚLJĐůŝŵďŝĨƉƌĞƐĞŶƚ ŽƌĂŶLJŝŶƐƚĂůůĞĚƐLJƐƚĞŵ͕^DZddŽŽůǀĞŶĚŽƌƚŽďĞŶŽƚŝĨŝĞĚƉƌŝŽƌƚŽŝŶƐƚĂůů͘ŶLJƐƉĞĐŝĂůƉŚŽƚŽƐ ŽƵƚƐŝĚĞŽĨƚŚĞƐƚĂŶĚĂƌĚƌĞƋƵŝƌĞŵĞŶƚƐǁŝůůďĞŝŶĚŝĐĂƚĞĚŽŶƚŚĞĚƌĂǁŝŶŐƐ͘ •WƌŽǀŝĚĞ͞ĂƐďƵŝůƚŵŽƵŶƚĚƌĂǁŝŶŐƐ͟ƐŚŽǁŝŶŐĐŽŶƚƌĂĐƚŽƌ͛ƐŶĂŵĞ͕ĐŽŶƚĂĐƚŝŶĨŽƌŵĂƚŝŽŶ͕ƉƌĞƉĂƌĞƌ͛Ɛ ƐŝŐŶĂƚƵƌĞ͕ĂŶĚĚĂƚĞ͘ŶLJĚĞǀŝĂƚŝŽŶƐĨƌŽŵƚŚĞĚƌĂǁŝŶŐƐ;WƌŽƉŽƐĞĚŵŽĚŝĨŝĐĂƚŝŽŶͿƐŚĂůůďĞƐŚŽǁŶ͘ EKd͗/ĨůŽĂĚŝŶŐŝƐĚŝĨĨĞƌĞŶƚƚŚĂŶǁŚĂƚŝƐĐŽŶǀĞLJĞĚŝŶƚŚĞƉĂƐƐŝŶŐŵŽƵŶƚĂŶĂůLJƐŝƐ;DͿĐŽŶƚĂĐƚ ƚŚĞ^DZddŽŽůǀĞŶĚŽƌŝŵŵĞĚŝĂƚĞůLJ͘ •ĂĐŚƉŚŽƚŽƐŚŽƵůĚďĞƚŝŵĞĂŶĚĚĂƚĞƐƚĂŵƉĞĚ •WŚŽƚŽƐƐŚŽƵůĚďĞŚŝŐŚƌĞƐŽůƵƚŝŽŶ͘ •ŽŶƚƌĂĐƚŽƌƐŚĂůůĞŶƐƵƌĞƚŚĂƚƚŚĞƐĂĨĞƚLJĐůŝŵďǁŝƌĞƌŽƉĞŝƐƐƵƉƉŽƌƚĞĚĂŶĚŶŽƚĂĚǀĞƌƐĞůLJ ŝŵƉĂĐƚĞĚďLJƚŚĞŝŶƐƚĂůůŽĨƚŚĞŵŽĚŝĨŝĐĂƚŝŽŶĐŽŵƉŽŶĞŶƚƐ͘dŚŝƐŵĂLJŝŶǀŽůǀĞƚŚĞŝŶƐƚĂůůŽĨǁŝƌĞ ƌŽƉĞŐƵŝĚĞƐ͕ŽƌŽƚŚĞƌŝƚĞŵƐƚŽƉƌŽƚĞĐƚƚŚĞǁŝƌĞƌŽƉĞ͘/ĨƚŚĞƌĞŝƐĐŽŶĨůŝĐƚ͕ĐŽŶƚĂĐƚƚŚĞ^DZddŽŽů ĞŶŐŝŶĞĞƌĨŽƌƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐ͘ •dŚĞWD/ĐĂŶďĞĂĐĐĞƐƐĞĚĂƚƚŚĞĨŽůůŽǁŝŶŐƉŽƌƚĂů͗KWWSVSPLY]ZVPDUWFRP  WŚŽƚŽZĞƋƵŝƌĞŵĞŶƚƐ͗  •WŚŽƚŽƐƚĂŬĞŶĂƚŐƌŽƵŶĚůĞǀĞů oWŚŽƚŽŽĨ'ĂƚĞ^ŝŐŶƐƐŚŽǁŝŶŐƚŚĞƚŽǁĞƌŽǁŶĞƌ͕ƐŝƚĞŶĂŵĞ͕ĂŶĚŶƵŵďĞƌ͘ oKǀĞƌĂůůƚŽǁĞƌƐƚƌƵĐƚƵƌĞĂĨƚĞƌŝŶƐƚĂůůĂƚŝŽŶ͘ oWŚŽƚŽƐŽĨƚŚĞŵŽƵŶƚĂĨƚĞƌŝŶƐƚĂůůĂƚŝŽŶ͖ŝĨƚŚĞŵŽƵŶƚƐĂƌĞĂƚĚŝĨĨĞƌĞŶƚƌĂĚĞůĞǀĂƚŝŽŶƐ͕ ƉŝĐƚƵƌĞƐŵƵƐƚďĞƉƌŽǀŝĚĞĚĨŽƌĂůůĞůĞǀĂƚŝŽŶƐƚŚĂƚĞƋƵŝƉŵĞŶƚǁĂƐŝŶƐƚĂůůĞĚ͘ •WŚŽƚŽƐƚĂŬĞŶĂƚDŽƵŶƚůĞǀĂƚŝŽŶ oWŚŽƚŽƐƐŚŽǁŝŶŐƚŚĞƐĂĨĞƚLJĐůŝŵďǁŝƌĞƌŽƉĞĂďŽǀĞĂŶĚďĞůŽǁƚŚĞŵŽƵŶƚƉƌŝŽƌƚŽ ŝŶƐƚĂůůĂƚŝŽŶ͘ oWŚŽƚŽƐƐŚŽǁŝŶŐƚŚĞĐůŝŵďŝŶŐĨĂĐŝůŝƚLJĂŶĚƐĂĨĞƚLJĐůŝŵďŝĨƉƌĞƐĞŶƚ͘ oWŚŽƚŽƐƐŚŽǁŝŶŐĞĂĐŚŝŶĚŝǀŝĚƵĂůƐĞĐƚŽƌĂĨƚĞƌŝŶƐƚĂůůĂƚŝŽŶ͘ĂĐŚĞŶƚŝƌĞƐĞĐƚŽƌƐŚĂůůďĞŝŶ ŽŶĞƉŚŽƚŽƚŽƐŚŽǁƚŚĞŝŶƚĞƌĐŽŶŶĞĐƚŝŽŶŽĨŵĞŵďĞƌƐ͘ dŚĞƐĞƉŚŽƚŽƐƐŚĂůůĂůƐŽĐĞƌƚŝĨLJƚŚĂƚƚŚĞƉůĂĐĞŵĞŶƚĂŶĚŐĞŽŵĞƚƌLJŽĨƚŚĞ ĞƋƵŝƉŵĞŶƚŽŶƚŚĞŵŽƵŶƚŝƐĂƐĚĞƉŝĐƚĞĚŝŶƚŚĞĂŶƚĞŶŶĂƉůĂĐĞŵĞŶƚĚŝĂŐƌĂŵŝŶƚŚŝƐ ĨŽƌŵ͘ oWŚŽƚŽƐƚŚĂƚƐŚŽǁƚŚĞŵŽĚĞůŶƵŵďĞƌŽĨĞĂĐŚĂŶƚĞŶŶĂĂŶĚƉŝĞĐĞŽĨĞƋƵŝƉŵĞŶƚŝŶƐƚĂůůĞĚ ƉĞƌƐĞĐƚŽƌ͘  ŶƚĞŶŶĂΘĞƋƵŝƉŵĞŶƚƉůĂĐĞŵĞŶƚĂŶĚ'ĞŽŵĞƚƌLJŽŶĨŝƌŵĂƚŝŽŶ͗  •dŚĞĐŽŶƚƌĂĐƚŽƌƐŚĂůůĐĞƌƚŝĨLJƚŚĂƚƚŚĞĂŶƚĞŶŶĂΘĞƋƵŝƉŵĞŶƚƉůĂĐĞŵĞŶƚĂŶĚŐĞŽŵĞƚƌLJŝƐŝŶ ĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƐŬĞƚĐŚĂŶĚƚĂďůĞĂƐŝŶĐůƵĚĞĚŝŶƚŚĞŵŽƵŶƚĂŶĂůLJƐŝƐĂŶĚŶŽƚĞĚďĞůŽǁ͘  ܆dŚĞĐŽŶƚƌĂĐƚŽƌĐĞƌƚŝĨŝĞƐƚŚĂƚƚŚĞƉŚŽƚŽƐƐƵƉƉŽƌƚĂŶĚƚŚĞĞƋƵŝƉŵĞŶƚŽŶƚŚĞŵŽƵŶƚŝƐĂƐĚĞƉŝĐƚĞĚŽŶ ƚŚĞƐŬĞƚĐŚĂŶĚƚĂďůĞŝŶĐůƵĚĞĚŝŶƚŚŝƐĨŽƌŵĂŶĚǁŝƚŚƚŚĞŵŽƵŶƚĂŶĂůLJƐŝƐƉƌŽǀŝĚĞĚ͘  KZ  ܆dŚĞĐŽŶƚƌĂĐƚŽƌŶŽƚĞƐƚŚĂƚƚŚĞĞƋƵŝƉŵĞŶƚŽŶƚŚĞŵŽƵŶƚŝƐŶŽƚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƐŬĞƚĐŚĂŶĚŚĂƐ ŶŽƚĞĚƚŚĞĚŝĨĨĞƌĞŶĐĞƐďĞůŽǁĂŶĚƉƌŽǀŝĚĞĚƉŚŽƚŽĚŽĐƵŵĞŶƚĂƚŝŽŶŽĨĂŶLJĂůƚĞƌĂƚŝŽŶƐ͘   ^ƉĞĐŝĂů/ŶƐƚƌƵĐƚŝŽŶƐͬsĂůŝĚĂƚŝŽŶĂƐƌĞƋƵŝƌĞĚĨƌŽŵƚŚĞDŽƌĂŶLJŽƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶƚŚĞĐŽŶƚƌĂĐƚŽƌ ĚĞĞŵƐŶĞĐĞƐƐĂƌLJƚŽƐŚĂƌĞƚŚĂƚǁĂƐŝĚĞŶƚŝĨŝĞĚ͗  /ƐƐƵĞ͗ /ŶƐƚĂůůŶĞǁϵϲ’’WϮ͘Ϭ^d;Ϯ͘ϯϳϱ’’džϬ͘ϭϱϰ’’ͿŵŽƵŶƚƉŝƉĞŝŶƉŽƐŝƚŝŽŶϯŽŶƚŚĞŐĂŵŵĂƐĞĐƚŽƌƉĞƌƚŚĞWƐ͘dŚĞƉŝƉĞ ƉƌŽũĞĐƚŝŽŶƐŚŽƵůĚŵĂƚĐŚƚŚĞĞdžŝƐƚŝŶŐϵϲ’’ůŽŶŐŵŽƵŶƚƉŝƉĞƐ͘hƐĞ;ϮͿŶĞǁst^DZdD^<ͲϭĐƌŽƐƐŽǀĞƌƐĨŽƌƚŚĞ ŝŶƐƚĂůůĂƚŝŽŶ͘  ZĞƐƉŽŶƐĞ͗      ^ƉĞĐŝĂů/ŶƐƚƌƵĐƚŝŽŶŽŶĨŝƌŵĂƚŝŽŶ͗  ܆dŚĞĐŽŶƚƌĂĐƚŽƌŚĂƐƌĞĂĚĂŶĚĂĐŬŶŽǁůĞĚŐĞƐƚŚĞĂďŽǀĞƐƉĞĐŝĂůŝŶƐƚƌƵĐƚŝŽŶƐ͘  ܆ůůŚĂƌĚǁĂƌĞůŝƐƚĞĚŝŶƚŚĞ^ƉĞĐŝĂů/ŶƐƚƌƵĐƚŝŽŶƐĂďŽǀĞ;ŝĨĂƉƉůŝĐĂďůĞͿŚĂƐďĞĞŶƉƌŽƉĞƌůLJ ŝŶƐƚĂůůĞĚ͕ĂŶĚƚŚĞĞdžŝƐƚŝŶŐŚĂƌĚǁĂƌĞǁĂƐŝŶƐƉĞĐƚĞĚ͘  տdŚĞŵĂƚĞƌŝĂůƵƚŝůŝnjĞĚǁĂƐĂƐƐƉĞĐŝĨŝĞĚŝŶƚŚĞ^DZddŽŽůĞŶŐŝŶĞĞƌŝŶŐǀĞŶĚŽƌ^ƉĞĐŝĂů/ŶƐƚƌƵĐƚŝŽŶƐ ĂďŽǀĞ;ŝĨĂƉƉůŝĐĂďůĞͿĂŶĚŝŶĐůƵĚĞĚŝŶƚŚĞŵĂƚĞƌŝĂůĐĞƌƚŝĨŝĐĂƚŝŽŶĨŽůĚĞƌŝƐĂƉĂĐŬŝŶŐůŝƐƚŽƌŝŶǀŽŝĐĞĨŽƌƚŚĞƐĞ ŵĂƚĞƌŝĂůƐ͘  KZ  տdŚĞŵĂƚĞƌŝĂůƵƚŝůŝnjĞĚǁĂƐĂƉƉƌŽǀĞĚďLJĂ^DZddŽŽůĞŶŐŝŶĞĞƌŝŶŐǀĞŶĚŽƌĂƐĂŶ͞ĞƋƵŝǀĂůĞŶƚ͟ĂŶĚƚŚŝƐ ĂƉƉƌŽǀĂůŝƐŝŶĐůƵĚĞĚĂƐƉĂƌƚŽĨƚŚĞĐŽŶƚƌĂĐƚŽƌƐƵďŵŝƐƐŝŽŶ͘  ŽŵŵĞŶƚƐ͗        ŽŶƚƌĂĐƚŽƌĐĞƌƚŝĨŝĞƐƚŚĂƚƚŚĞĐůŝŵďŝŶŐĨĂĐŝůŝƚLJͬƐĂĨĞƚLJĐůŝŵďǁĂƐŶŽƚĚĂŵĂŐĞĚƉƌŝŽƌƚŽƐƚĂƌƚŝŶŐǁŽƌŬ͗  տzĞƐ տEŽ  ŽŶƚƌĂĐƚŽƌĐĞƌƚŝĨŝĞƐŶŽŶĞǁĚĂŵĂŐĞĐƌĞĂƚĞĚĚƵƌŝŶŐƚŚĞĐƵƌƌĞŶƚŝŶƐƚĂůůĂƚŝŽŶ͗  տzĞƐ տEŽ  ŽŶƚƌĂĐƚŽƌƚŽĐĞƌƚŝĨLJƚŚĞĐŽŶĚŝƚŝŽŶŽĨƚŚĞƐĂĨĞƚLJĐůŝŵďĂŶĚǀĞƌŝĨLJŶŽĚĂŵĂŐĞǁŚĞŶůĞĂǀŝŶŐƚŚĞƐŝƚĞ͗  տ^ĂĨĞƚLJůŝŵďŝŶ'ŽŽĚŽŶĚŝƚŝŽŶ տ^ĂĨĞƚLJůŝŵďĂŵĂŐĞĚ  ŽŶƚƌĂĐƚŽƌƚŽƉƌŽǀŝĚĞŵĞĂƐƵƌĞŵĞŶƚĨƌŽŵƚŽƉŽĨƚŚĞŚŝŐŚĞƐƚĞƋƵŝƉŵĞŶƚͬƐƚĞĞůƚŽƚŚĞďŽƚƚŽŵŽĨƚŚĞ ůŽǁĞƐƚĞƋƵŝƉŵĞŶƚͬƐƚĞĞůďLJĚŽĐƵŵĞŶƚŝŶŐŝƚƵƐŝŶŐƚŚĞŵŽƐƚĂƉƉƌŽƉƌŝĂƚĞŝůůƵƐƚƌĂƚŝŽŶďĞůŽǁĂůŽŶŐǁŝƚŚ ƐƵƉƉŽƌƚŝŶŐƉŚŽƚŽƐ͗            /ůůƵƐƚƌĂƚŝŽŶηϭ/ůůƵƐƚƌĂƚŝŽŶηϮ ĞƌƚŝĨLJŝŶŐ/ŶĚŝǀŝĚƵĂů͗  ŽŵƉĂŶLJ͗  ŵƉůŽLJĞĞEĂŵĞ͗  ŽŶƚĂĐƚWŚŽŶĞ͗  ŵĂŝů͗  ĂƚĞ͗          Structure: 5000001247-VZW - MALL BETA Sector: Structure Type: Mount Elev: A Water Tank 10219851 123.00 4/11/2024 Page: 1 Plan View Front View - Looking at Structure Copyright 2019 by Tower Engineering Solutions, LLC. All Rights Reserved 1234 A2 R3 A2 R4 A1 A5 A10 Structure Height Width H Dist Pipe Pipe Ant C. Ant Ant Ref# Model (in) (in) Frm L. # Pos V Pos Frm T. H Off Status Validation A2 NHH-65C-R2B 96 11.9 98 1 a Front 30 0 Added R3 B2/B66A RRH ORAN (RF4439d-25A) 15 15 98 1 a Behind 72 0 Added A2 NHH-65C-R2B 96 11.9 61 2 a Front 78 0 Added R4 RF4461d-13A 15 15 61 2 a Behind 36 0 Added A1 MT6413-77A 28.9 15.8 32 3 a Front 30 0 Added A5 RVZDC-6627-PF-48 29.5 16.5 32 3 a Behind 48 0 Added A10 Beacon 28 17.5 4 a Front 12 0 Retained AAAAAAAAAAAAAAA Structure: 5000001247-VZW - MALL BETA Sector: Structure Type: Mount Elev: B Water Tank 10219851 123.00 4/11/2024 Page: 2 Plan View Front View - Looking at Structure Copyright 2019 by Tower Engineering Solutions, LLC. All Rights Reserved 1234 A2 R3 A2 R4 A1 A11 Structure Height Width H Dist Pipe Pipe Ant C. Ant Ant Ref# Model (in) (in) Frm L. # Pos V Pos Frm T. H Off Status Validation A2 NHH-65C-R2B 96 11.9 98 1 a Front 30 0 Added R3 B2/B66A RRH ORAN (RF4439d-25A) 15 15 98 1 a Behind 72 0 Added A2 NHH-65C-R2B 96 11.9 61 2 a Front 78 0 Added R4 RF4461d-13A 15 15 61 2 a Behind 36 0 Added A1 MT6413-77A 28.9 15.8 32 3 a Front 30 0 Added A11 16 inch dish 0 0 4 a Front 12 0 Retained 12222222222222222233333333333333344444444444444 AAAAAAA2A22222222A2222A222222222222A22A22222A22 RRRR3RRRRRRRRRRRRRRRRRRRR3RR33333RR3RR3R3R333333RRRR33333RRRR3RRR3RR33R3RR33RRRR A2A2A2222AAA222222222222A222222222222222222222AA22222222222222222 RRRRRR4R4R4R4R4444R4R4R44R4444R44R44R444444444444 AAAAAAA111111111111A11111A11A11A1AA1A11AAAAA1A A11A Structure: 5000001247-VZW - MALL BETA Sector: Structure Type: Mount Elev: C Water Tank 10219851 123.00 4/11/2024 Page: 3 Plan View Front View - Looking at Structure Copyright 2019 by Tower Engineering Solutions, LLC. All Rights Reserved 1234 A2 R3 A2 R4 A1 A11 Structure Height Width H Dist Pipe Pipe Ant C. Ant Ant Ref# Model (in) (in) Frm L. # Pos V Pos Frm T. H Off Status Validation A2 NHH-65C-R2B 96 11.9 98 1 a Front 30 0 Added R3 B2/B66A RRH ORAN (RF4439d-25A) 15 15 98 1 a Behind 72 0 Added A2 NHH-65C-R2B 96 11.9 61 2 a Front 78 0 Added R4 RF4461d-13A 15 15 61 2 a Behind 36 0 Added A1 MT6413-77A 28.9 15.8 32 3 a Front 30 0 Added A11 16 inch dish 0 0 4 a Front 12 0 Retained Updated on 12-17-2021 FCC # N/A Sector / Position Vertical Offset Dimension "u" Horizontal Offset "C1, C2, C3, etc." Sector / Position Vertical Offset Dimension "u" Horizontal Offset "C1, C2, C3, etc." A1 93.50 17.00 C1 141.50 6.00 A2 141.50 56.50 C2 93.50 50.00 A3 93.50 98.00 C3 A4 C4 A5 C5 A6 C6 B1 93.50 17.00 D1 B2 141.50 56.50 D2 B3 93.50 98.00 D3 B4 D4 B5 D5 B6 D6 Photos of antennas Tower Face Width at Mount Elev. (ft.): Mounting Locations [Units are inches and degrees]Enter antenna model. If not labeled, enter "Unknown". Tower Leg Size or Pole Shaft Diameter at Mount Elev. (in.): Please insert the sketches of the antenna mount from the "Sketches" tab with dimensions and members here. Tower Owner: Site Name: Site Number or ID: Mapping Contractor: This antenna mapping form is the property of TES and under PATENT PENDING. The formation contained herein is considered confidential in nature and is to be used only for the specific customer it was intended for. Reproduction, transmission, publication, modification or disclosure by any method is prohibited except by express written permission of TES. All means and methods are the responsibility of the contractor and the work shall be compliant with ANSI/ASSE A 10.48, OSHA, FCC, FAA and other safety requirements that may apply. TES is not warrantying the usability of the safety climb as it must be assessed prior to each use in compliance with OSHA requirements. Mount elevation taken from three internal measurements within water tower of 20', 40' and 65.5'. MP horizontal offset taken from edge of first handrail panel of sector. Distance from top of bottom support rail to lowest tip of ant./eqpt. of Carrier above. (N/A if > 10 ft.) : Distance from top of bottom support rail to highest tip of ant./eqpt. of Carrier below. (N/A if > 10 ft.) : Please enter additional infomation or comments below. 2.375"x .154"x 96" 3.5" x .216" x 144" 2.375"x .154"x 96" Mount Pipe Configuration and Geometries [Unit = Inches] Mount Pipe Size & Length 2.375"x .154"x 96" 3.5" x .216" x 144" 2.375"x .154"x 96" Mount Pipe Size & Length 3.5" x .216" x 144" 2.375"x .154"x 96" Antenna Mount Mapping Form (PATENT PENDING) ATC Mapping Date:2/13/2024 5000001247-VZW Tower Type:Other 417486 Tower Height (Ft.):UNKNOWN SGS Towers Mount Elevation (Ft.):125.5 2 V4.1 Antenna Models if Known Width (in.) Depth (in.) Height (in.) Coax Size and Qty Antenna CenterͲ line (Ft.) Vertical Distances"b1a, b2a, b3a, b1b…." (Inches) Horiz. Offset "h" (Use "Ͳ" if Ant. is behind) Antenna Azimuth (Degrees) Photo Numbers Ant1a UNKNOWN PANEL 11.00 5.75 47.00 (3) 5/8", (125.5 27.00 10.00 0.00 195 Ant1b 9442 RRH2X40ͲAWSͲ4 10.60 6.70 24.40 89.00 Ͳ9.00 206 Ant1c Ant2a RHSDCͲ3315ͲPFͲ48 15.73 10.25 25.66 80.00 Ͳ9.00 224 Ant2b Ant2c Ant3a HTXCW631619R000G 12.00 7.10 89.50 125.5 32.00 Ͳ10.00 0.00 233 Ant3b 9442 RRH2X40ͲAWSͲ4 10.60 6.70 24.40 89.00 Ͳ9.00 241 Ant3c Ant4a Ant4b Ant4c Ant5a Ant5b Ant5c Ant on Standoff Ant on Standoff Ant on Tower Ant on TowerAntenna Layout (Looking Out From Tower) Sector A Ant1a UNKNOWN PANEL 11.00 5.75 47.00 125.5 27.00 10.00 120.00 248 Sector A:0.00 Deg Leg A: Deg Ant1b 9442 RRH2X40ͲAWSͲ4 10.60 6.70 24.40 89.00 Ͳ9.00 251 Sector B:120.00 Deg Leg B: Deg Ant1c Sector C:240.00 Deg Leg C: Deg Ant2a EMPTY Sector D: Deg Leg D: Deg Ant2b Ant2c Location: 160.00 Ant3a HTXCW631619R000G 12.00 7.10 89.50 125.5 32.00 Ͳ10.00 120.00 272 Ant3b Ant3c Ant4a Ant4b Ant4c Ant5a Ant5b Ant5c Ant on Standoff Ant on Standoff Ant on Tower Ant on Tower Ant1a UNKNOWN PANEL 11.00 5.75 47.00 125.5 74.00 11.00 240.00 286 Ant1b Ant1c Ant2a HTXCW631619R000G 12.00 7.10 89.50 125.5 32.00 Ͳ10.00 240.00 300 Ant2b Ant2c Ant3a Ant3b Ant3c Ant4a Ant4b Ant4c Ant5a Ant5b Ant5c Ant on Standoff Ant on Standoff Ant on Tower Ant on Tower Ant1a Ant1b Ant1c Ant2a Ant2b Ant2c Ant3a Ant3b Ant3c Ant4a Ant4b Ant4c Ant5a Ant5b Ant5c Ant on Standoff Ant on Standoff Ant on Tower Ant on Tower Climbing Facility Information Please insert a photo of the mount centerline measurement here. Deg N/A N/A N/A N/A Sector BMount Azimuth (Degree) for Each Sector Tower Leg Azimuth (Degree) for Each Sector Climbing Facility Corrosion Type: Access: Condition: Sector C Sector D Issue #Photo # 1 2 3 4 5 6 7 8 Standard Conditions 1. Obvious safety and structural issues/deficiencies noticed at the time of the mount mapping are to be reported in this mapping. However, this mount mapping is not a condition assessment of the mount. 6. Please measure and report the size and length of all existing antenna mounting pipes. 8. Don't delete or rearrange any sheet or contents of any sheet from this mapping form. 7. Please measure and report the antenna information for all sectors. Observed Safety and Structural Issues During the Mount Mapping 2. If the thickness of the existing pipes or tubing can't be obtained from a general tool (such as Caliper), please use an ultrasonic measurement tool (thickness gauge) to measure the thickness. 3. Please create all required detail sketches of the mounts and insert them into the "Sketches" tab. 4. Please measure and enter the bolt sizes and types under the Members Box in the spreadsheet of the mount type. 5. Take and label the photos of the tower, mounts, connections, antennas and all measurements. Minimum 50 photos are required. Mapping Notes 1. Please report any visible structural or safety issues observed on the antenna mounts (Damaged members, loose connections, tilting mounts, safety climb issues, etc.) Description of Issue Updated on 12-17-2021 FCC # N/A Tower Owner: Site Name: Site Number or ID: Mapping Contractor: Please Insert Sketches of the Antenna Mount This antenna mapping form is the property of TES and under PATENT PENDING. The formation contained herein is considered confidential in nature and is to be used only for the specific customer it was intended for. Reproduction, transmission, publication, modification or disclosure by any method is prohibited except by express written permission of TES. All means and methods are the responsibility of the contractor and the work shall be compliant with ANSI/ASSE A 10.48, OSHA, FCC, FAA and other safety requirements that may apply. TES is not warrantying the usability of the safety climb as it must be assessed prior to each use in compliance with OSHA requirements. Antenna Mount Mapping Form (PATENT PENDING) ATC Mapping Date:2/13/2024 5000001247-VZW Tower Type:Other 417486 Tower Height (Ft.):UNKNOWN SGS Towers Mount Elevation (Ft.):125.5 V4.1 All connections welded unless otherwise noted. P1.9" x .145" P1.9" x .145" A B C 17" 17" 6" 56.5" 56.5" 50" 98" 98" A/B Only Ant1a Ant3a Ant3a Ant1a Ant1a Ant2a Ant1b Ant2b Ant1b Equipment Plan View Elevation View MP Elevation View Please Insert Sketches of the Antenna Mount, cont'd Please Insert Sketches of the Antenna Mount, cont'd 3DXO-)RUG .0- 3URMHFW1R 9=:B07B/2B+ 6. $SUDW30 9=:B07B/2B+UG < ;= (QYHORSH2QO\6ROXWLRQ 3DXO-)RUG .0- 3URMHFW1R 9=:B07B/2B+ 6. $SUDW30 9=:B07B/2B+UG                                                                                                                                                                                                                                             < ;= &RGH&KHFN (QY 1R&DOF !     0HPEHU&RGH&KHFNV'LVSOD\HG (QYHORSHG (QYHORSH2QO\6ROXWLRQ 3DXO-)RUG .0- 3URMHFW1R 9=:B07B/2B+ 6. $SUDW30 9=:B07B/2B+UG                                                                                                                                                                                                                                             < ;= 6KHDU&KHFN (QY 1R&DOF !     0HPEHU6KHDU&KHFNV'LVSOD\HG (QYHORSHG (QYHORSH2QO\6ROXWLRQ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ *OREDO 0RGHO6HWWLQJV 'LVSOD\6HFWLRQVIRU0HPEHU&DOFV 0D[,QWHUQDO6HFWLRQVIRU0HPEHU&DOFV ,QFOXGH6KHDU'HIRUPDWLRQ" ,QFUHDVH1DLOLQJ&DSDFLW\IRU:LQG" ,QFOXGH:DUSLQJ" 7UDQV/RDG%WZQ,QWHUVHFWLQJ:RRG:DOO" $UHD/RDG0HVK LQA 0HUJH7ROHUDQFH LQ 3'HOWD$QDO\VLV7ROHUDQFH ,QFOXGH3'HOWDIRU:DOOV" $XWRPDWLFDOO\,WHUDWH6WLIIQHVVIRU:DOOV" 0D[,WHUDWLRQVIRU:DOO6WLIIQHVV *UDYLW\$FFHOHUDWLRQ IWVHFA :DOO0HVK6L]H LQ (LJHQVROXWLRQ&RQYHUJHQFH7RO ( 9HUWLFDO$[LV *OREDO0HPEHU2ULHQWDWLRQ3ODQH 6WDWLF6ROYHU '\QDPLF6ROYHU   <HV <HV 1R <HV    <HV 1R     < ;= 6SDUVH$FFHOHUDWHG $FFHOHUDWHG6ROYHU +RW5ROOHG6WHHO&RGH $GMXVW6WLIIQHVV" 5,6$&RQQHFWLRQ&RGH &ROG)RUPHG6WHHO&RGH :RRG&RGH :RRG7HPSHUDWXUH &RQFUHWH&RGH 0DVRQU\&RGH $OXPLQXP&RGH 6WDLQOHVV6WHHO&RGH $,6&WK  /5)' <HV ,WHUDWLYH 1RQH 1RQH 1RQH ) 1RQH 1RQH 1RQH%XLOGLQJ 1RQH 1XPEHURI6KHDU5HJLRQV 5HJLRQ6SDFLQJ,QFUHPHQW LQ %LD[LDO&ROXPQ0HWKRG 3DUPH%HWD)DFWRU 3&$ &RQFUHWH6WUHVV%ORFN 8VH&UDFNHG6HFWLRQV" 8VH&UDFNHG6HFWLRQV6ODE" %DG)UDPLQJ:DUQLQJV" 8QXVHG)RUFH:DUQLQJV" 0LQ%DU'LDP6SDFLQJ" &RQFUHWH5HEDU6HW 0LQ6WHHOIRU&ROXPQ 0D[6WHHOIRU&ROXPQ   ([DFW,QWHJUDWLRQ  5HFWDQJXODU <HV <HV 1R <HV 1R 5(%$5B6(7B$670$   5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ *OREDO 0RGHO6HWWLQJV&RQWLQXHG 6HLVPLF&RGH 6HLVPLF%DVH(OHYDWLRQ IW $GG%DVH:HLJKW" &W; &W= 7; VHF 7= VHF 5; 5= &W([S; &W([S= 6' 6'6 6 7/ VHF 2FFXSDQF\&DW 'ULIW&DW $6&( 1RW(QWHUHG 1R   1RW(QWHUHG 1RW(QWHUHG        1RW(QWHUHG ,RU,, 2WKHU 2P= 2P; &G= &G; 5KR= 5KR;       +RW5ROOHG6WHHO3URSHUWLHV /DEHO (>NVL@ *>NVL@ 1X 7KHUP  'HQVLW\>NIWA@ <LHOG>NVL@ 5\ )X>NVL@ 5W $*U $*U $ $*U $*U $*U% NVL  4*U% $*U% +RW5ROOHG6WHHO6HFWLRQ6HWV /DEHO 6KDSH 7\SH 'HVLJQ/LVW 0DWHULDO 'HVLJQ5XOHV $>LQ@ ,\\>LQ@ ,]]>LQ@ ->LQ@ )DFH+RUL]R3,3(B1RQH 1RQH $*U% 7\SLFDO  6WDQGRII3LSH 3,3(B1RQH 1RQH $*U% 7\SLFDO  6WDQGRII3ODWH 3/[1RQH 1RQH 4*U%7\SLFDO  7LH%DFN 3,3(B1RQH 1RQH $*U% 7\SLFDO  %UDFLQJ65B1RQH 1RQH $*U% 7\SLFDO  %UDFLQJ65 65B1RQH 1RQH $*U% 7\SLFDO  %UDFLQJ65B1RQH 1RQH $*U% 7\SLFDO  0RXQW3LSH 3,3(B1RQH 1RQH $*U% 7\SLFDO  6WDQGRII0D3,3(B1RQH 1RQH $*U% 7\SLFDO  0HPEHU3ULPDU\'DWD /DEHO ,-RLQW --RLQW .-RLQW 5RWDWH  6HFWLRQ6KDSH 7\SH 'HVLJQ/LVW 0DWHULDO 'HVLJQ5 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ 0HPEHU3ULPDU\'DWD &RQWLQXHG /DEHO ,-RLQW --RLQW .-RLQW 5RWDWH  6HFWLRQ6KDSH 7\SH 'HVLJQ/LVW 0DWHULDO 'HVLJQ5 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 5/995,*,'1RQH 1RQH 5,*,'7\SLFDO 03$993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03$993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03$993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03%993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03%993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03%993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03&993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 03&993,3(B1RQH 1RQH $*U% NVL 7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 73113/;1RQH 1RQH $*U7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 75113,3(B1RQH 1RQH $*U%7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 93113,3(B1RQH 1RQH $*U7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ 0HPEHU3ULPDU\'DWD &RQWLQXHG /DEHO ,-RLQW --RLQW .-RLQW 5RWDWH  6HFWLRQ6KDSH 7\SH 'HVLJQ/LVW 0DWHULDO 'HVLJQ5 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO /9 223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO 05223,3(B1RQH 1RQH $*U%7\SLFDO /0115,*,'1RQH 1RQH 5,*,'7\SLFDO /0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 03&113,3(B%HDP :LGH)ODQ$*U%7\SLFDO 011/[[%HDP :LGH)ODQ$*U7\SLFDO 011/[[%HDP :LGH)ODQ$*U7\SLFDO 011/[[%HDP :LGH)ODQ$*U7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 03&113,3(B1RQH 1RQH $*U% NVL 7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 03$113,3(B%HDP :LGH)ODQ$*U%7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 0115,*,'1RQH 1RQH 5,*,'7\SLFDO 03%113,3(B%HDP :LGH)ODQ$*U%7\SLFDO 0HPEHU$GYDQFHG'DWD /DEHO ,5HOHDVH -5HOHDVH ,2IIVHW>LQ@ -2IIVHW>LQ@ 7&2QO\ 3K\VLFDO 'HIO5DW$QDO\VLV ,QDFWLYH 6HLVPLF 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 5/<HV 1$ 1RQH 03$<HV 1$ 1RQH 03$<HV 1$ 1RQH 03$<HV 1$ 1RQH 03%<HV 1$ 1RQH 03%<HV 1$ 1RQH 03%<HV 1$ 1RQH 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ 0HPEHU$GYDQFHG'DWD &RQWLQXHG /DEHO ,5HOHDVH -5HOHDVH ,2IIVHW>LQ@ -2IIVHW>LQ@ 7&2QO\ 3K\VLFDO 'HIO5DW$QDO\VLV ,QDFWLYH 6HLVPLF 03&<HV 1$ 1RQH 03&<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 73<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 75<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 93<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH /9 <HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ 0HPEHU$GYDQFHG'DWD &RQWLQXHG /DEHO ,5HOHDVH -5HOHDVH ,2IIVHW>LQ@ -2IIVHW>LQ@ 7&2QO\ 3K\VLFDO 'HIO5DW$QDO\VLV ,QDFWLYH 6HLVPLF 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH 05<HV 1$ 1RQH /0<HV 1$ 1RQH /0<HV 1$ 1RQH 0<HV 1$ 1RQH 0<HV 1$ 1RQH 0<HV 1$ 1RQH 0<HV 1$ 1RQH 0<HV 1$ 1RQH 0<HV 1$ 1RQH 0222;2;<HV 1$ 1RQH 0222;2;<HV 1$ 1RQH 03&<HV 1RQH 0%HQ3,1 %HQ3,1 <HV 1RQH 0%HQ3,1 %HQ3,1 <HV 1RQH 0%HQ3,1 %HQ3,1 <HV 1RQH 0<HV 1$ 1RQH 03&<HV 1$ 1RQH 0<HV 1$ 1RQH 0222;2;<HV 1$ 1RQH 0222;2;<HV 1$ 1RQH 03$<HV 1RQH 0222;2;<HV 1$ 1RQH 0222;2;<HV 1$ 1RQH 03%<HV 1RQH +RW5ROOHG6WHHO'HVLJQ3DUDPHWHUV /DEHO 6KDSH /HQJWK>IW@ /E\\>IW@ /E]]>IW@ /FRPSWRS>IW@ /FRPSERW>IW@ /WRUTX .\\ .]] &E )XQFWLRQ 03$3,3(B/E\\/DWHUDO 03$3,3(B/E\\/DWHUDO 03$3,3(B/E\\/DWHUDO 03%3,3(B/E\\/DWHUDO 03%3,3(B/E\\/DWHUDO 03%3,3(B/E\\/DWHUDO 03&3,3(B/E\\/DWHUDO 03&3,3(B/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 733/;/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ +RW5ROOHG6WHHO'HVLJQ3DUDPHWHUV &RQWLQXHG /DEHO 6KDSH /HQJWK>IW@ /E\\>IW@ /E]]>IW@ /FRPSWRS>IW@ /FRPSERW>IW@ /WRUTX .\\ .]] &E )XQFWLRQ 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 753,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 933,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO /9 3,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 053,3(B/E\\/DWHUDO 03&3,3(B/E\\/DWHUDO 0/[[/E\\/DWHUDO 0/[[/E\\/DWHUDO 0/[[/E\\/DWHUDO 03&3,3(B/E\\/DWHUDO 03$3,3(B/E\\/DWHUDO 03%3,3(B/E\\/DWHUDO 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ %DVLF/RDG&DVHV %/&'HVFULSWLRQ &DWHJRU\ ;*UDYLW\ <*UDYLW\ =*UDYLW\ -RLQW 3RLQW 'LVWULEXW$UHD 0H6XUIDFH  $QWHQQD'1RQH  $QWHQQD'L 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:R 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:L 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  $QWHQQD:P 'HJ 1RQH  6WUXFWXUH'1RQH  6WUXFWXUH'L 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:R 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ %DVLF/RDG&DVHV &RQWLQXHG %/&'HVFULSWLRQ &DWHJRU\ ;*UDYLW\ <*UDYLW\ =*UDYLW\ -RLQW 3RLQW 'LVWULEXW$UHD 0H6XUIDFH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:L 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  6WUXFWXUH:P 'HJ 1RQH  /P1RQH  /P1RQH  /Y1RQH  /Y1RQH  $QWHQQD(Y 1RQH  $QWHQQD(K 'HJ 1RQH  $QWHQQD(K 'HJ 1RQH  6WUXFWXUH(Y (/< 6WUXFWXUH(K 'HJ (/= 6WUXFWXUH(K 'HJ (/; /RDG&RPELQDWLRQV 'HVFULSWLRQ 6RO 3'HOWD 6566%/&)DFW %/& )DFWRU %)D%)D%)D%)D%)D%)D%)D%)D ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ':R 'HJ <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < ''L:L <HV < 5,6$'9HUVLRQ3DJH>&????????????0RGHO)LOHV?9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ /RDG&RPELQDWLRQV &RQWLQXHG 'HVFULSWLRQ 6RO 3'HOWD 6566%/&)DFW %/& )DFWRU %)D%)D%)D%)D%)D%)D%)D%)D ''L:L <HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/P:<HV < '/Y<HV < '/Y<HV < '<HV < '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( '(Y(K <HV <((( 5,6$'9HUVLRQ3DJH>&?????????????9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ (QYHORSH-RLQW5HDFWLRQV -RLQW ;>OE@ /& <>OE@ /& =>OE@ /& 0;>NIW@ /& 0<>NIW@ /& 0=>NIW@ /& 1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  1PD[ PLQ  7RWDOVPD[ PLQ  (QYHORSH$,6&WK  /5)'6WHHO&RGH&KHFNV 0HP 6KDSH &RGH&KHFN /RF>IW@/6KHDU/RF>IW@ 'LU /& SKL 3SKL SKL 0Q\SKL 0Q](TQ 0/[[\+ 0/[[\+ 753,3(B+ 753,3(B+ 753,3(B+ 933,3(B+ 933,3(B+ 933,3(B+ 933,3(B+ 03$3,3(B+ 933,3(B+ 933,3(B+ 753,3(B+ 053,3(B+ 933,3(B+ 053,3(B+ 053,3(B+ 053,3(B+ 053,3(B+ 933,3(B+ 933,3(B+ 053,3(B+ 753,3(B+ 753,3(B+ 03$3,3(B+ 5,6$'9HUVLRQ3DJH>&?????????????9=:B07B/2B+UG@ &RPSDQ\  3DXO-)RUG $SU 30'HVLJQHU  .0- -RE1XPEHU  3URMHFW1R &KHFNHG%\BBBBB 0RGHO1DPH  9=:B07B/2B+ (QYHORSH$,6&WK  /5)'6WHHO&RGH&KHFNV &RQWLQXHG 0HP 6KDSH &RGH&KHFN /RF>IW@/6KHDU/RF>IW@ 'LU /& SKL 3SKL SKL 0Q\SKL 0Q](TQ 0/[[\+ 053,3(B+ 933,3(B+ 03&3,3(B+ 753,3(B+ 933,3(B+ /9 3,3(B+ 933,3(B+ 753,3(B+ 03%3,3(B+ 03%3,3(B+ 03$3,3(B+ 03&3,3(B+ 053,3(B+ 753,3(B+ 053,3(B+ 053,3(B+ 053,3(B+ 733/;\+ 733/;\+ 053,3(B+ 03&3,3(B+ 03%3,3(B+ 03%3,3(B+ 053,3(B+ 733/;\+ 733/;\+ 733/;\+ 053,3(B+ 733/;\+ 053,3(B+ 053,3(B+ 053,3(B+ 733/;\+ 733/;\+ 733/;\+ 053,3(B+ 03&3,3(B+ 03$3,3(B+ 053,3(B+ 053,3(B+ 753,3(B+ 053,3(B+ 053,3(B+ 733/;\+ 753,3(B+ 053,3(B+ 733/;\+ 733/;\+ 753,3(B+ 5,6$'9HUVLRQ3DJH>&?????????????9=:B07B/2B+UG@ ASCE Hazards Report Address: No Address at This Location Standard:ASCE/SEI 7-16 Latitude:36.110256 Risk Category:III Longitude:-94.089739 Soil Class:D - Default (see Section 11.4.3) Elevation:1546.9621167140724 ft (NAVD 88) Wind Results: Wind Speed 114 Vmph 10-year MRI 74 Vmph 25-year MRI 81 Vmph 50-year MRI 86 Vmph 100-year MRI 92 Vmph Data Source: ASCE/SEI 7-16, Fig. 26.5-1C and Figs. CC.2-1–CC.2-4, and Section 26.5.2 Date Accessed: Thu Apr 11 2024 Value provided is 3-second gust wind speeds at 33 ft above ground for Exposure C Category, based on linear interpolation between contours. Wind speeds are interpolated in accordance with the 7-16 Standard. Wind speeds correspond to approximately a 3% probability of exceedance in 50 years (annual exceedance probability = 0.000588, MRI = 1,700 years). Site is not in a hurricane-prone region as defined in ASCE/SEI 7-16 Section 26.2. Page 1 of 3https://ascehazardtool.org/Thu Apr 11 2024 SS : 0.164 S1 : 0.093 F a :1.6 F v :2.4 SMS : 0.262 SM1 : 0.222 SDS : 0.175 S D1 :0.148 T L :12 PGA : 0.078 PGA M :0.125 F PGA :1.6 Ie :1.25 C v :0.7 Seismic Design Category: C Design Response SpectrumDesign Response Spectrum S (g) vs T(s)a MCE Response SpectrumRSeSeSeSeSeSeSeisisisisisisismic Design Category:Csponse SpectrumCategory:Category:CCegeg S (g) vs T(s)a Design Vertical Response SpectrumDesign Vertical Response Spectrum S (g) vs T(s)a MCE Vertical Response SpectrumRMCE Vertical Response Spectrum S (g) vs T(s)a Seismic D - Default (see Section 11.4.3)Site Soil Class: Results: Data Accessed: Thu Apr 11 2024 Date Source: USGS Seismic Design Maps based on ASCE/SEI 7-16 and ASCE/SEI 7-16 Table 1.5-2. Additional data for site-specific ground motion procedures in accordance with ASCE/SEI 7-16 Ch. 21 are available from USGS. Page 2 of 3https://ascehazardtool.org/Thu Apr 11 2024 Ice Results: Data Source: Date Accessed: Ice Thickness: 2.00 in. Concurrent Temperature: 5 F Gust Speed 30 mph Standard ASCE/SEI 7-16, Figs. 10-2 through 10-8 Thu Apr 11 2024 Ice thicknesses on structures in exposed locations at elevations higher than the surrounding terrain and in valleys and gorges may exceed the mapped values. Values provided are equivalent radial ice thicknesses due to freezing rain with concurrent 3-second gust speeds, for a 500-year mean recurrence interval, and temperatures concurrent with ice thicknesses due to freezing rain. Thicknesses for ice accretions caused by other sources shall be obtained from local meteorological studies. Ice thicknesses in exposed locations at elevations higher than the surrounding terrain and in valleys and gorges may exceed the mapped values. The ASCE Hazard Tool is provided for your convenience, for informational purposes only, and is provided “as is” and without warranties of any kind. The location data included herein has been obtained from information developed, produced, and maintained by third party providers; or has been extrapolated from maps incorporated in the ASCE standard. While ASCE has made every effort to use data obtained from reliable sources or methodologies, ASCE does not make any representations or warranties as to the accuracy, completeness, reliability, currency, or quality of any data provided herein. Any third-party links provided by this Tool should not be construed as an endorsement, affiliation, relationship, or sponsorship of such third-party content by or from ASCE. ASCE does not intend, nor should anyone interpret, the results provided by this Tool to replace the sound judgment of a competent professional, having knowledge and experience in the appropriate field(s) of practice, nor to substitute for the standard of care required of such professionals in interpreting and applying the contents of this Tool or the ASCE standard. In using this Tool, you expressly assume all risks associated with your use. Under no circumstances shall ASCE or its officers, directors, employees, members, affiliates, or agents be liable to you or any other person for any direct, indirect, special, incidental, or consequential damages arising from or related to your use of, or reliance on, the Tool or any information obtained therein. To the fullest extent permitted by law, you agree to release and hold harmless ASCE from any and all liability of any nature arising out of or resulting from any use of data provided by the ASCE Hazard Tool. Page 3 of 3https://ascehazardtool.org/Thu Apr 11 2024 Amendment No. 1 to the Engineering Services Agreement for North College Avenue Water Main Replacement Date: ________________ WHEREAS, the CITY OF FAYETTEVILLE and McClelland Consulting Engineers, Inc. (ENGINEER) entered into an Agreement for Professional Engineering Services (AGREEMENT) on June 5, 2018; and, WHEREAS, the CITY OF FAYETTEVILLE has requested that ENGINEER perform additional services outside of the scope of the AGREEMENT. NOW THEREFORE, the following modifications will be made to the AGREEMENT to include the additional services requested: MODIFICATIONS: 1. Section 2.1.1 – the additional scope of services is included in the attached Appendix “A-1”. 2. Section 5.1 – the maximum not-to-exceed amount is increased from $128,930.00 to $164,230.00. Modifications to compensation are included in the attached Appendix “A-2”. IN WITNESS WHEREOF, the parties execute this Amendment No. 1, to be effective on the date set out above. McClelland Consulting Engineers, Inc. City of Fayetteville, Arkansas BY: ____________________________ BY: _______________________________ Nicholas R. Batker, P.E. Mayor Lioneld Jordan Senior Associate Appendix A-1 – Scope of Additional Services Page 1 of 2 North College Avenue Water Main Replacement APPENDIX A-1 – SCOPE OF ADDITIONAL SERVICES AMENDMENT NO. 1 TO THE ENGINEERING SERVICES AGREEMENT FOR THE NORTH COLLEGE AVENUE WATER MAIN REPLACEMENT 1.0 General The scope of additional services includes limited construction administration and construction observation services for the referenced project, which consists of approximately 3,000 linear feet of 12-inch water main, 360 linear feet of 8-inch sewer main and related water and sewer appurtenances along North College Avenue between North Street and Sycamore Street. This project is part of the North College Avenue roadway improvements, Bid 24-34. Construction is anticipated to commence in late 2024 and a duration of 210 calendar days is assumed for construction of the water and sewer improvements. 2.0 Construction Phase Services 2.1 Construction Administration The ENGINEER will provide limited construction administration services to the CITY OF FAYETTEVILLE in this Amendment No. 1 as it relates only to the water and sewer portion of the overall project. The following services are included in this task:  Attend the pre-construction meeting with the Contractor.  Review and respond to Contractor submittals for conformance to the Contract Documents, Drawings, and Specifications.  Review Contractor’s Requests for Information (RFIs) and issue clarifications as required.  Assist the CITY OF FAYETTEVILLE with the evaluation, negotiation, and processing of Contractor change order requests.  Assist the CITY OF FAYETTEVILLE with review of Pay Estimates and associated quantities as requested. It is assumed that CITY OF FAYETTEVILLE and/or design engineer for the roadway improvements project will process Pay Estimates.  Conduct site visits to observe the progress and quality of the completed work to determine compliance with the Contract Documents. Attend monthly progress meetings if requested by the CITY OF FAYETTEVILLE. A total of twelve (12) site visits/progress meetings are estimated.  Conduct final inspection and develop punch list. Review punch list of outstanding items and closeout documents provided by the Contractor.  Prepare Record Drawings based upon as-built survey and information furnished by the Contractor and field representatives and provide to the CITY OF FAYETTEVILLE in AutoCAD and PDF format. Appendix A-1 – Scope of Additional Services Page 2 of 2 North College Avenue Water Main Replacement 2.2 Construction Observation The CITY OF FAYETTEVILLE intends to provide comprehensive construction observation services on this project with in-house staff. However, if requested in writing by the CITY OF FAYETTEVILLE with minimum three (3) business days’ notice, the ENGINEER will provide construction observation services up to a maximum of 50 hours on this project. ENGINEER will not provide construction observation services without prior authorization by the CITY OF FAYETTEVILLE. 3.0 Project Deliverables The ENGINEER will provide the following deliverables to the CITY OF FAYETTEVILLE. Unless otherwise noted, deliverables will be in PDF format and transmitted via email or file share service. 3.1 Record Drawings  AutoCAD files  PDF copy  One (1) full-size hard copy 3.2 Daily Construction Observation Reports (if Construction Observation Services are requested and authorized by the CITY OF FAYETTEVILLE). 3.3 Other electronic files as requested by the CITY OF FAYETTEVILLE. 4.0 Compensation In consideration of the performance of the foregoing services by the ENGINEER, the CITY OF FAYETTEVILLE will by to the ENGINEER compensation as follows: 4.1 Compensation will be paid to the ENGINEER on the basis of ENGINEER’s standard hourly rates in effect at the time the work is performed, plus reimbursable expenses. A task hour fee breakdown is provided as Appendix A-2. ENGINEER’s current rate schedule is attached hereto as Appendix A-3. 4.2 The maximum not-to-exceed for Amendment No. 1 will be $35,300. 4.3 The maximum not-to-exceed total contract amount is increased from $128,930.00 to $164,230.00 5.0 Additional Services Should Additional Services be required, the ENGINEER and CITY OF FAYETTEVILLE will agree on the scope and not-to-exceed amount of the Additional Services, and said Additional Services will be authorized under a future amendment to this Agreement. APPENDIX A-2 City of Fayetteville - N College Avenue Water Main Replacement Amendment No. 1 - Services During Construction Personnel Hour Fee Estimate 8/23/2024 Task Description Sr. Project Manager Project Manager Project Engineer/ Designer CAD/GIS Technician Const Observer Extended Cost Pre-Construction Meeting 2 2 $700.00 Review Contractor's Submittals 8 20 $4,600.00 Review Contractor's RFIs, Field Orders, & Work Change Directives 1 8 20 4 $5,250.00 Change Management (Change Orders)1 6 8 4 $3,050.00 Assist with Pay Estimates and Quantities 8 8 $2,800.00 Monthly Progress Meetings/Site Visits (12 total assumed)16 16 $5,600.00 Final Inspection and Project Closeout 1 4 12 $2,850.00 Prepare Record Drawings and Final Deliverables 1 4 12 24 $5,250.00 Subtotal Labor Hours / Fee - Scope Item 2.1 4 56 98 32 0 $30,100.00 Estimated Reimbursable Expenses Mileage $100.00 Subtotal Reimbursable Expenses - Scope Item 2.1 $100.00 Total Scope Item 2.1 - Construction Administration 4 56 98 32 0 $30,200.00 Field Observation Services - Requires Prior Authorization by City of Fayetteville 0 0 0 0 50 $5,000.00 Subtotal Labor Hours / Fee - Scope Item 2.2 0 0 0 0 50 $5,000.00 Estimated Reimbursable Expenses Mileage $100.00 Subtotal Reimbursable Expenses - Scope Item 2.2 $100.00 Total Scope Item 2.2 - Construction Observation 0 0 0 0 50 $5,100.00 GRAND TOTAL AMENDMENT NO. 1 4 56 98 32 50 $35,300.00 Scope Item 2.1 - Construction Administration Scope Item 2.2 - Construction Observation Page 1 of 1 Chief Draftsman $110 - $120 Clerical $45 - $85 Construction Observer $75 - $165 Draftsman $70 - $120 Environmental Scientist/Designer $125 - $145 Geotech Engineer $125 - $200 GIS Technician $80 - $140 HR/Payroll Admin $75-$115 Landscape Architect $95 - $200 Media Specialist $85 - $120 Principal $185 - $275 Project Accountant $70 - $155 Project Designer - Intern $50 - $80 Project Designer $80 - $165 Project Engineer $120 - $175 Project Manager $130 - $210 Registered Land Surveyor $100 - $175 Soils Lab Technician $50 - $140 Specification Writer $50 - $100 Sr. Project Manager $160 - $250 Structural Engineer $140 - $180 Survey (2 man or Robotic) Crew $115 - $165 Survey (3 man) Crew $150 - $200 Survey Field (1 Man or Rodman) $45 - $120 Survey GPS $75 - $135 Survey Technician $65 - $110 Expenses @ Cost Mileage .705/mi * Standard Hourly Rates may be adjusted annually in accordance with the normal salary review practices of McClelland Consulting Engineers. 8/7/2023 McCLELLAND CONSULTING ENGINEERS, INC. *STANDARD HOURLY RATES APPENDIX A-3